• Featured Product
  • KD/KO Validated

Calsequestrin 2 Polyclonal antibody

Calsequestrin 2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 18422-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Calsequestrin 2, CASQ2, PDIB2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human heart tissue, human skeletal muscle tissue, pig heart tissue, rat heart tissue
Positive IHC detected inhuman heart tissue, human kidney tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cell

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18422-1-AP targets Calsequestrin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13246

Product name: Recombinant human CASQ2 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-399 aa of BC022288

Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Predict reactive species
Full Name calsequestrin 2 (cardiac muscle)
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC022288
Gene Symbol Calsequestrin 2
Gene ID (NCBI) 845
RRIDAB_2071473
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14958
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

Protocols

Product Specific Protocols
IF protocol for Calsequestrin 2 antibody 18422-1-APDownload protocol
IHC protocol for Calsequestrin 2 antibody 18422-1-APDownload protocol
WB protocol for Calsequestrin 2 antibody 18422-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Proc Natl Acad Sci U S A

Subcellular activation of β-adrenergic receptors using a spatially restricted antagonist

Authors - Federica Liccardo
mouseWB

EMBO Mol Med

SK4 K(+) channels are therapeutic targets for the treatment of cardiac arrhythmias.

Authors - Shiraz Haron-Khun
mouseWB,IF

JCI Insight

The Purkinje-myocardial junction is the anatomical origin of ventricular arrhythmia in CPVT.

Authors - Daniel J Blackwell
  • KO Validated
mouseWB,IF

Heart Rhythm

Viral delivered gene therapy to treat catecholaminergic polymorphic ventricular tachycardia (CPVT2) in mouse models.

Authors - Efrat Kurtzwald-Josefson
  • KO Validated
humanWB

Stem Cell Reports

A Human Stem Cell Model of Fabry Disease Implicates LIMP-2 Accumulation in Cardiomyocyte Pathology.

Authors - Matthew J Birket

Mol Biol Cell

Fer1l6 Is Essential for the Development of Vertebrate Muscle Tissue in Zebrafish.

Authors - Josephine A Bonventre
Loading...
||
New chat Able
正在加载,请稍候...