Tested Applications
| Positive WB detected in | Raji cells, HepG2 cells, THP-1 cells, U-937 cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | / HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22915-1-AP targets Caspase 1/P20 in WB, IHC, IF/ICC, IP, ELISA, Cell treatment, Western Blot applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, monkey, chicken, hamster, duck |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11143 Product name: Recombinant human Caspase 1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-311 aa of BC062327 Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH Predict reactive species |
| Full Name | caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) |
| Calculated Molecular Weight | 404 aa, 45 kDa |
| Observed Molecular Weight | 45-47 kDa, 30 kDa, 35 kDa |
| GenBank Accession Number | BC062327 |
| Gene Symbol | Caspase 1 |
| Gene ID (NCBI) | 834 |
| RRID | AB_2876874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29466 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 22915-1-AP can recognize p45 procaspase and the mature fragment p20.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Caspase 1/P20 antibody 22915-1-AP | Download protocol |
| WB protocol for Caspase 1/P20 antibody 22915-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Caspase 1/P20 Polyclonal antibody (Cat# 22915-1-AP) has accumulated 1,411 citations across high-impact journals including Nature Neuroscience, Nature Communications, Cell Research, Cell Stem Cell, Cell Death & Disease, Redox Biology, Autophagy, ACS Nano, J Neuroinflammation, Phytomedicine, and Theranostics. Research fields span pyroptosis, NLRP3 inflammasome activation, neuroinflammation, cancer immunotherapy, cardiovascular disease, metabolic disorders, gut microbiome regulation, and oxidative stress–mediated injury.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther 2-APQC, a small-molecule activator of Sirtuin-3 (SIRT3), alleviates myocardial hypertrophy and fibrosis by regulating mitochondrial homeostasis | ||
Signal Transduct Target Ther MELK is an oncogenic kinase essential for metastasis, mitotic progression, and programmed death in lung carcinoma. | ||
Mol Cancer Metal-enriched HSP90 nanoinhibitor overcomes heat resistance in hyperthermic intraperitoneal chemotherapy used for peritoneal metastases | ||
Nat Chem Eng Hydrogen evolution and dynamics in hydrogel electrochemical cells for ischemia-reperfusion therapy. | ||
Adv Mater A Targeted, Tandem-Activated Artificial Urinary Biomarker Sensor for Early Detection and Therapeutic Intervention of Thoracic Aortic Aneurysm and Dissection. |
Reviews
What customers say
All four reviews are positive, with ratings of 4–5 stars. Users consistently report successful Western Blot performance. One reviewer detected both pro-caspase-1 and its p20 cleaved product in PDAC cell lines at a 1:1000 dilution. Another confirmed reliable results on mouse brain tissue at 1:500 dilution. Two additional reviewers simply noted that the antibody "worked well" in their WB experiments. Overall, customers find this antibody effective and specific for Western Blot applications across different sample types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anne (Verified Customer) (04-01-2025) | It worked well in the Western Blot experiment.
|
Anne (Verified Customer) (01-31-2025) | It worked well in the Western Blot experiment.
|
Joseph (Verified Customer) (02-19-2020) | This antibody detected pro-caspase 1 and the p20 cleaved product in PDAC cell lines. I did not look for the p10 cleaved product.
|
Tanusree (Verified Customer) (12-03-2019) | This antibody works good in western blotting analysis using mouse tissues.
|
