calreticulin Polyclonal antibody

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10292-1-AP

  WB result of calreticulin antibody (10292-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-calreticulin transfected HeLa cells.

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 10292-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 10292-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 10292-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 10292-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10292-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded normal colon slide using 10292-1-AP (calreticulin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

• 

  FC experiment of Jurkat using 10292-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human calreticulin (10292-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

calreticulin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10292-1-AP

Publications(115)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), CoIP, ELISA

Synonyms

CALR, CRT, Calregulin

---

Tested Applications

• Positive WB detected in: HL-60 cells, A549 cells, mouse brain tissue, COLO 320 cells, NIH/3T3 cells, human skeletal muscle tissue, rat brain tissue, HeLa cells, HepG2 cells, MCF-7 cells, SH-SY5Y cells
• Positive IHC detected in: human thyroid tissue, human normal colon, human skeletal muscle tissue, human thyroid cancer tissue, mouse colon tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 54 publications below
• IHC: See 15 publications below
• FC: See 3 publications below
• CoIP: See 1 publications below

Product Information

10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0325

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC002500

  Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_2069615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		ACS Nano; ER-Targeting PDT Converts Tumors into In Situ Therapeutic Tumor Vaccines.; Authors - Xu Liu
mouse	WB	ACS Nano; Nanointegrative In Situ Reprogramming of Tumor-Intrinsic Lipid Droplet Biogenesis for Low-Dose Radiation-Activated Ferroptosis Immunotherapy; Authors - Qiqi Zhang
		ACS Nano; An Implantable Double-Layered Spherical Scaffold Depositing Gene and Cell Agents to Facilitate Collaborative Cancer Immunotherapy; Authors - Sibei Lei
mouse		ACS Nano; Starting the Engine and Releasing the Brakes of T-Cell Responses: A Biomimetic Dendritic Cell Nanoplatform for Improved Glioblastoma Immunotherapy; Authors - Lei Kuang
human	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
		Adv Sci (Weinh); Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine; Authors - Jiaxin Huang