calreticulin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• calreticulin Polyclonal antibody (10292-1-AP)

• Featured Product
• KD/KO Validated

calreticulin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10292-1-AP Copied!

Publications (168)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, FC (Intra), CoIP, ELISA

Synonyms

CALR, Calregulin, CRT

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10292-1-AP

  WB result of calreticulin antibody (10292-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-calreticulin transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10292-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10292-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 10292-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 10292-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded normal colon slide using 10292-1-AP (calreticulin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 10292-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human calreticulin (10292-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for calreticulin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, A549 cells, COLO 320 cells, HeLa cells, mouse brain tissue, NIH/3T3 cells, rat brain tissue, HepG2 cells, MDA-MB-231 cells, MCF-7 cells, SH-SY5Y cells, L02 cells
• Positive IHC detected in: human thyroid tissue, human normal colon, human skeletal muscle tissue, human thyroid cancer tissue, mouse colon tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0325

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC002500

  Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_2069615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Publications

What published studies show

The anti-Calreticulin antibody (Cat# 10292-1-AP) has accumulated 168 citations published in high-impact journals including Nature, Signal Transduction and Targeted Therapy, Advanced Materials, Nature Communications, ACS Nano, Biomaterials, Journal of Controlled Release, Science Advances, and Acta Pharmaceutica Sinica B. Key research fields include cancer immunotherapy and immunogenic cell death, ferroptosis and cuproptosis, endoplasmic reticulum stress, nanomedicine and drug delivery, ER-mitochondria signaling, autophagy, proteomics, and neuroscience.

Automatically generated from the 168 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Signal Transduct Target Ther; A20 promotes colorectal cancer immune evasion by upregulating STC1 expression to block "eat-me" signal; Authors - Min Luo
mouse		Signal Transduct Target Ther; Spatiotemporally programmed nanomedicine engineering to resolve conflicting immunosignals in triple-negative breast cancer.; Authors - Xiuping Guo
human	WB	Nature; EndoMAP.v1 charts the structural landscape of human early endosome complexes; Authors - Miguel A Gonzalez-Lozano
mouse		J Hematol Oncol; Glutathione reductase deficiency potentiates the immunogenicity of ferroptosis and cuproptosis via amplified reactive oxygen species accumulation and cGAS-STING pathway activation; Authors - Xiaoyi Deng
human	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
		Adv Mater; Reprogramming the Immunosuppressive Microenvironment in Triple-Negative Breast Cancer via FAP-Targeted Nanoprobes for Multimodal Imaging and Photothermal Therapy.; Authors - Ling Zhan