Tested Applications
| Positive WB detected in | fetal human brain tissue, mouse brain tissue, rat brain tissue, mouse cerebellum tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human cerebellum tissue, hippocampus, human brain tissue, human kidney tissue, mouse cerebellum tissue, mouse kidney tissue, rat cerebellum tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue, human kidney tissue |
| Positive IF-Fro detected in | mouse cerebellum tissue, rat cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 11 publications below |
| IF | See 28 publications below |
Product Information
14479-1-AP targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species |
| Full Name | calbindin 1, 28kDa |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC006478 |
| Gene Symbol | Calbindin |
| Gene ID (NCBI) | 793 |
| RRID | AB_2228318 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05937 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Calbindin-D28k antibody 14479-1-AP | Download protocol |
| IHC protocol for Calbindin-D28k antibody 14479-1-AP | Download protocol |
| IP protocol for Calbindin-D28k antibody 14479-1-AP | Download protocol |
| WB protocol for Calbindin-D28k antibody 14479-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Glia-to-Neuron Conversion by CRISPR-CasRx Alleviates Symptoms of Neurological Disease in Mice. | ||
Nat Neurosci Aerobic glycolysis is the predominant means of glucose metabolism in neuronal somata, which protects against oxidative damage | ||
Autophagy Heat-shock chaperone HSPB1 mitigates poly-glycine-induced neurodegeneration via restoration of autophagic flux | ||
Cell Death Differ The long noncoding RNA Synage regulates synapse stability and neuronal function in the cerebellum. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Georgiana (Verified Customer) (09-11-2023) | Antibody labelled cell bodies and dendrites very clearly
![]() |
FH Ramzi (Verified Customer) (06-14-2023) | The brain vibratome sections were treated with Acid-Alcohol before the blocking solution.
![]() |
FH Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|
FH Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|

































































