BMPR1A Polyclonal antibody

• 

  WB analysis using 12702-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12702-1-AP

  WB result of BMPR1A antibody (12702-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-BMPR1A transfected MCF-7 cells.

• 

  WB analysis of human skeletal muscle using 12702-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 12702-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12702-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12702-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12702-1-AP (BMPR1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 12702-1-AP

  IP result of anti-BMPR1A (IP:12702-1-AP, 4ug; Detection:12702-1-AP 1:500) with HEK-293 cells lysate 2000ug.

• 

  IF Staining of HeLa using 12702-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using BMPR1A antibody (12702-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of U2OS using 12702-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using BMPR1A antibody (12702-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

BMPR1A Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 12702-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Activin receptor like kinase 3, Activin receptor-like kinase 3, ACVRLK3, ALK 3, ALK3

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, human heart tissue, human skeletal muscle tissue, MCF-7 cells, mouse liver tissue, Jurkat cells, K-562 cells, U2OS cells
• Positive IP detected in: HEK-293 cells
• Positive IF/ICC detected in: HeLa cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 11 publications below
• IHC: See 1 publications below
• IF: See 4 publications below
• IP: See 1 publications below

Product Information

12702-1-AP targets BMPR1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3410

  Product name: Recombinant human BMPR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-427 aa of BC028383

  Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM

• Full Name: bone morphogenetic protein receptor, type IA
• Calculated Molecular Weight: 532 aa, 60 kDa
• Observed Molecular Weight: 60-68 kDa
• GenBank Accession Number: BC028383
• Gene Symbol: BMPR1A
• Gene ID (NCBI): 657
• RRID: AB_2064273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36894
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biol; A PINCH-1-Smurf1 signaling axis mediates mechano-regulation of BMPR2 and stem cell differentiation.; Authors - Ling Guo
human	IP	Sci Signal; Reverse signaling by semaphorin 4C elicits SMAD1/5- and ID1/3-dependent invasive reprogramming in cancer cells.; Authors - Sreeharsha Gurrapu
mouse	WB,IF	Front Cell Dev Biol; Hormone-Responsive BMP Signaling Expands Myoepithelial Cell Lineages and Prevents Alveolar Precocity in Mammary Gland.; Authors - Chunlei Shao
mouse	WB	PLoS One; Effect of miR-20b on Apoptosis, Differentiation, the BMP Signaling Pathway and Mitochondrial Function in the P19 Cell Model of Cardiac Differentiation In Vitro.; Authors - Shasha Zhu
human	WB	Biochim Biophys Acta Gen Subj; Expression of GALNT8 and O-glycosylation of BMP receptor 1A suppress breast cancer cell proliferation by upregulating ERα levels; Authors - Tianmiao Huang
rat	WB	Sci Rep; Hypoxia inducible factor-1 mediates expression of miR-322: potential role in proliferation and migration of pulmonary arterial smooth muscle cells.; Authors - Yan Zeng