cIAP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• cIAP2 Polyclonal antibody (24304-1-AP)

cIAP2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24304-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

BIRC3, Baculoviral IAP repeat-containing protein 3, BIRC 3, C IAP2, Cellular inhibitor of apoptosis 2

• 

  WB analysis using 24304-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24304-1-AP (cIAP2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24304-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24304-1-AP (cIAP2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 24304-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 24304-1-AP (cIAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U-937 using 24304-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 24304-1-AP (cIAP2 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Daudi using 24304-1-AP

  IP result of anti-cIAP2 (IP:24304-1-AP, 4ug; Detection:24304-1-AP 1:1000) with Daudi cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24304-1-AP (cIAP2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24304-1-AP (cIAP2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24304-1-AP (cIAP2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24304-1-AP (cIAP2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24304-1-AP (cIAP2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24304-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24304-1-AP (cIAP2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for cIAP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, HeLa cells, RAW 264.7 cells, U-937 cells, Raji cells
• Positive IP detected in: Daudi cells
• Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24304-1-AP targets cIAP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20143

  Product name: Recombinant human BIRC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 78-169 aa of BC027485

  Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE

• Full Name: baculoviral IAP repeat-containing 3
• Calculated Molecular Weight: 604 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC027485
• Gene Symbol: cIAP2
• Gene ID (NCBI): 330
• RRID: AB_2879485
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13489
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies.

Publications

What published studies show

The anti-BIRC3 antibody (Cat# 24304-1-AP) has 24 citations across 21 journals, including Cell Death & Disease, Developmental Cell, Oncotarget, iScience, Cancer Medicine, Frontiers in Oncology, and Biochemical & Biophysical Research Communications. Research fields span apoptosis regulation, cancer biology (hepatocellular, gastric, glioma, breast, lung, colorectal, renal, and nasopharyngeal carcinomas), autophagy, NF-κB signaling, diabetes-related cognitive impairment, and atherosclerosis. Applications are predominantly Western blot and IHC in human and rat samples.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Death Dis; The novel ZEB1-upregulated protein PRTG induced by Helicobacter pylori infection promotes gastric carcinogenesis through the cGMP/PKG signaling pathway.; Authors - Tian Xiang
human	WB	Cell Death Dis; Cellular FLICE-like inhibitory protein (cFLIP) critically maintains apoptotic resistance in human lens epithelial cells.; Authors - Jingru Huangfu
human	WB	Dev Cell; Selective Autophagy of Mitochondria on a Ubiquitin-Endoplasmic-Reticulum Platform.; Authors - Maria Zachari
human	WB,IHC	J Clin Transl Hepatol; Dysregulation of PLOD2 Promotes Tumor Metastasis and Invasion in Hepatocellular Carcinoma; Authors - Keren Li
human	WB	Cancer Biol Ther; Survivin knockdown combined with apoptin overexpression inhibits cell growth significantly.; Authors - Liu Qin Q
human	WB	Oncotarget; The putative tumor activator ARHGEF3 promotes nasopharyngeal carcinoma cell pathogenesis by inhibiting cellular apoptosis.; Authors - Tian-Hao Liu