BAX Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Publications

4

Cat no : Ag0576

Synonyms

BCL2L4



Product Information

Peptide Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
(1-192 aa encoded by BC014175)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Publications

SpeciesTitle

Nanoscale Res Lett

Cytotoxicity induced by nanobacteria and nanohydroxyapatites in human choriocarcinoma cells.

Authors - Mingjun Zhang

EBioMedicine

OCIAD1 contributes to neurodegeneration in Alzheimer's disease by inducing mitochondria dysfunction, neuronal vulnerability and synaptic damages.

Authors - Xuping Li
human

Cell Death Dis

DRAM1 regulates apoptosis through increasing protein levels and lysosomal localization of BAX.

Authors - J-J Guan

Clin Cancer Res

Effect of a Smac Mimetic (TL32711, Birinapant) on the Apoptotic Program and Apoptosis Biomarkers Examined with Validated Multiplex Immunoassays Fit for Clinical Use.

Authors - Apurva K Srivastava