ATPB Polyclonal antibody

• 

  WB analysis using 17247-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17247-1-AP (ATPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17247-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17247-1-AP (ATPB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 17247-1-AP

  IP result of anti-ATPB (IP:17247-1-AP, 3ug; Detection:17247-1-AP 1:500) with mouse heart tissue lysate 7500ug.

• 

  IHC staining of human colon using 17247-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 17247-1-AP (ATPB antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 17247-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ATPB antibody (17247-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 17247-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ATPB antibody (17247-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

ATPB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17247-1-AP

Publications(72)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:7.1.2.2, ATPSB, ATPMB, ATP5F1B, ATP5B

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, HT-29 cells, HepG2 cells, mouse brain tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 66 publications below
• IHC: See 3 publications below
• IF: See 5 publications below
• IP: See 4 publications below
• CoIP: See 1 publications below

Product Information

17247-1-AP targets ATPB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11177

  Product name: Recombinant human ATPB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-529 aa of BC016512

  Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

• Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
• Calculated Molecular Weight: 529 aa, 57 kDa
• Observed Molecular Weight: 45-57 kDa
• GenBank Accession Number: BC016512
• Gene Symbol: ATPB
• Gene ID (NCBI): 506
• RRID: AB_2061878
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06576
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; DNA of neutrophil extracellular traps promotes cancer metastasis via CCDC25.; Authors - Linbin Yang
mouse	WB,IF	Nat Struct Mol Biol; TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.; Authors - Xinxin Zuo
mouse	WB	Sci Adv; Proteomimetic polymer blocks mitochondrial damage, rescues Huntington's neurons, and slows onset of neuropathology in vivo; Authors - Wonmin Choi
human	WB	Nat Commun; Small-molecule suppression of calpastatin degradation reduces neuropathology in models of Huntington's disease.; Authors - Di Hu
mouse	WB	Nat Commun; ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimer's disease models.; Authors - Yuanyuan Zhao
human	WB	Brain; Ligand-free mitochondria-localized mutant AR-induced cytotoxicity in spinal bulbar muscular atrophy.; Authors - Xia Feng