ATP5O Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATP5O Polyclonal antibody (10994-1-AP)

ATP5O Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10994-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

ATP5PO, ATP synthase peripheral stalk subunit OSCP, ATPO, OSCP

• 

  WB analysis using 10994-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10994-1-AP (ATP5O antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 10994-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 10994-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 10994-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 10994-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 10994-1-AP (OSCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10994-1-AP (OSCP antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10994-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10994-1-AP (ATP5O antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 10994-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug ATP5O Polyclonal antibody (10994-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATP5O in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse placenta tissue, mouse liver tissue, mouse heart tissue, mouse colon tissue, Caco-2 cells, HCT116 cells, HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human testis tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10994-1-AP targets ATP5O in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1458

  Product name: Recombinant human ATP5O protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC021233

  Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

• Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC021233
• Gene Symbol: ATP5O
• Gene ID (NCBI): 539
• RRID: AB_2062063
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48047
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP5O(ATP synthase subunit O, mitochondrial) is also named as ATPO, OSCP and belongs to the ATPase delta chain family. The gene encodes the oligomycin sensitivity-conferring protein (OSCP) of ATP synthase. The predicted polypeptide is 213 amino acids long with more than 80% identity to the bovine and mouse homologs and it is expressed at highest levels in muscle and heart by the northern blot(PMID:7490082). Many studies have indicated that mitochondrial dysfunction is central to the development of most age-related human diseases including neurodegenerative diseases, cancer, and type 2 diabetes.

Publications

What published studies show

The ATP5O Polyclonal antibody (Cat# 10994-1-AP) has 11 citations published in journals including NPJ Parkinson's Disease, Neural Regen Res, Free Radic Biol Med, Front Cell Dev Biol, Brain Pathol, Cancers, J Mol Biol, Eur J Nutr, Front Oncol, Oncol Lett, and Dis Markers. Research fields span Parkinson's disease, mitochondrial dysfunction, oxidative phosphorylation in diabetes, protein lactylation, fatal familial insomnia, prostate cancer, cytochrome c oxidase biogenesis, mitochondrial biogenesis, metabolic reprogramming, thyroid carcinoma, and breast cancer prognosis.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Neural Regen Res; CHCHD2 Thr61Ile mutation impairs F1F0-ATPase assembly in in vitro and in vivo models of Parkinson's disease; Authors - Xiang Chen
mouse	WB	NPJ Parkinsons Dis; Enhancing mitochondrial proteolysis alleviates alpha-synuclein-mediated cellular toxicity; Authors - Xi Zhang
mouse	WB	Free Radic Biol Med; Low-intensity pulsed ultrasound ameliorates pancreatic injury and glucose metabolism in type 2 diabetic mice: regulatory role of the oxidative phosphorylation pathway.; Authors - Chen Ni
mouse	WB	Front Cell Dev Biol; Multi-omics study on the effect of moderate-intensity exercise on protein lactylation in mouse muscle tissue; Authors - Jiahui Chang
human	WB	Brain Pathol; Fatal familial insomnia: mitochondrial and protein synthesis machinery decline in the mediodorsal thalamus.; Authors - Margalida A Frau-Méndez
human	IHC	Cancers (Basel); Proteomic Analysis Identifies NDUFS1 and ATP5O as Novel Markers for Survival Outcome in Prostate Cancer.; Authors - Robert Wiebringhaus