• Featured Product
  • KD/KO Validated

GABARAPL1 Polyclonal antibody

GABARAPL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11010-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

APG8 LIKE, APG8L, ATG8, ATG8L, Early estrogen-regulated protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HepG2 cells, human heart tissue, mouse liver tissue, rat brain tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inmouse brain tissue, human ovary tumor tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inChloroquine treated HeLa cells, Chloroquine treated HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11010-1-AP targets GABARAPL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, prawn
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1473

Product name: Recombinant human ATG8L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-117 aa of BC009309

Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Predict reactive species
Full Name GABA(A) receptor-associated protein like 1
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC009309
Gene Symbol GABARAPL1
Gene ID (NCBI) 23710
RRIDAB_2294415
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0R8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GABARAPL1 (GABARAP-like protein 1), also named ATG8, GEC1, APG8L, ATG8L, and APG8-LIKE, is a member of the GABARP (GABAA receptor-associated protein) family. GABARAPL1 was initially identified as an estrogen-regulated gene, and the protein acts in receptor and vesicle transport. It's also involved in the process of autophagy, like GABARAP and GABARAPL2, and may be considered an autophagic marker. It is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle, and at very low levels in the thymus and small intestine. The antibody is specific to GABARAPL1, and it doesn't recognize the recombinant GABARAP and GABARAPL2.

Protocols

Product Specific Protocols
IF protocol for GABARAPL1 antibody 11010-1-APDownload protocol
IHC protocol for GABARAPL1 antibody 11010-1-APDownload protocol
IP protocol for GABARAPL1 antibody 11010-1-APDownload protocol
WB protocol for GABARAPL1 antibody 11010-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Circulation

Markers of autophagy are downregulated in failing human heart after mechanical unloading.

Authors - Kassiotis Christos C
humanWB,IP,IF

J Extracell Vesicles

Secretion of pro-angiogenic extracellular vesicles during hypoxia is dependent on the autophagy-related protein GABARAPL1.

Authors - Tom G Keulers
mouseWB

Cell Metab

FoxO3 coordinately activates protein degradation by the autophagic/lysosomal and proteasomal pathways in atrophying muscle cells.

Authors - Zhao Jinghui J
mouseWB

Autophagy

Analysis of ATG4C function in vivo

Authors - Isaac Tamargo-Gómez
mouseWB,IF

J Clin Invest

Autophagy is essential for mouse sense of balance.

Authors - Mari?o Guillermo G
rat,humanWB

Autophagy

The role of GABARAPL1/GEC1 in autophagic flux and mitochondrial quality control in MDA-MB-436 breast cancer cells.

Authors - Michaël Boyer-Guittaut
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Margaux (Verified Customer) (06-07-2024)

Efficient to immunoprecipitate GABARAPL1 but I used another antibody to see it because it didn't work for my western-blot in my experimental conditions.

  • Applications: Immunoprecipitation
FH

H (Verified Customer) (04-06-2020)

I could not detect GABARAP L1 in HEK293T and HCT116 cells. It is possible that the expression level of GABARAP L1 in these two cell lines are extremely low. In proteomics analysis of the HEK293T whole cell lysates, however, we could detect GABARAP L1.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T and HCT116
GABARAPL1 Antibody Western Blot validation (1:1000 dilution) in HEK293T and HCT116 (Cat no:11010-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...