ATG2B Polyclonal antibody

• 

  WB analysis of HeLa using 25155-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25155-1-AP (ATG2B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 25155-1-AP (ATG2B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 25155-1-AP (ATG2B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 25155-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 25155-1-AP (ATG2B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 25155-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ATG2B antibody (25155-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

ATG2B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25155-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

C14orf103, Autophagy-related protein 2 homolog B

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human pancreas cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 15 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

25155-1-AP targets ATG2B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18412

  Product name: Recombinant human ATG2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1304-1555 aa of BC015016

  Sequence: RDYVRVMDMGLLELTITAVKSDSDGEQTEPRFELHCSSDVVHIRTCSDSCAALMNLIQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVS

• Full Name: ATG2 autophagy related 2 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 2078 aa, 233 kDa
• Observed Molecular Weight: 240-250 kDa
• GenBank Accession Number: BC015016
• Gene Symbol: ATG2B
• Gene ID (NCBI): 55102
• RRID: AB_2810874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A phosphoinositide signalling pathway mediates rapid lysosomal repair; Authors - Jay Xiaojun Tan
human	WB	Nat Cell Biol; ATG9A protects the plasma membrane from programmed and incidental permeabilization.; Authors - Aurore Claude-Taupin ; KO Validated
human	IF	Nat Commun; The autophagy protein ATG9A enables lipid mobilization from lipid droplets.; Authors - Elodie Mailler ; KO Validated
human	WB	Autophagy; SHISA5/SCOTIN restrains spontaneous autophagy induction by blocking contact between the ERES and phagophores.; Authors - Jee-Eun Lee
human	WB	Autophagy; Architecture of the ATG2B-WDR45 complex and an aromatic Y/HF motif crucial for complex formation.; Authors - Jing-Xiang Zheng
human	WB,IF	EMBO Rep; A conserved ATG2-GABARAP family interaction is critical for phagophore formation.; Authors - Mihaela Bozic