ASPM Polyclonal antibody

• 

  WB analysis using 26223-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26223-1-AP (ASPM antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human gliomas using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 26223-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 26223-1-AP (ASPM antibody), at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with alpha tubulin (66031-1-Ig, red).

• Featured Product
• KD/KO Validated

ASPM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26223-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ASP, Asp homolog, ASPM, Calmbp1, MCPH5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, K-562 cells
• Positive IHC detected in: human prostate cancer tissue, human gliomas tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 9 publications below
• IHC: See 9 publications below
• IF: See 5 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

26223-1-AP targets ASPM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24166

  Product name: Recombinant human ASPM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-95 aa of BC034607

  Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT

• Full Name: asp (abnormal spindle) homolog, microcephaly associated (Drosophila)
• Calculated Molecular Weight: 410 kDa or 218 kDa
• Observed Molecular Weight: 218 kDa
• GenBank Accession Number: BC034607
• Gene Symbol: ASPM
• Gene ID (NCBI): 259266
• RRID: AB_2880431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IP	Aging (Albany NY); ASPM promotes glioblastoma growth by regulating G1 restriction point progression and Wnt-β-catenin signaling.; Authors - Xin Chen ; KD Validated
human	IHC	Int J Cancer; Development and validation of a five-gene model to predict postoperative brain metastasis in operable lung adenocarcinoma.; Authors - Fangqiu Fu
human	WB	Front Oncol; Identifying and Validating Potential Biomarkers of Early Stage Lung Adenocarcinoma Diagnosis and Prognosis.; Authors - Yingji Chen
mouse	IHC	J Biol Chem; The Transcription factor NF-YA is Crucial for Neural Progenitor Maintenance during Brain Development; Authors - Tomoyuki Yamanaka
human	WB	DNA Cell Biol; ASPM is a Novel Candidate Gene Associated with Colorectal Cancer Cell Growth.; Authors - Qian Yang
human	WB,IHC	Int J Endocrinol; ASPM Promotes the Progression of Anaplastic Thyroid Carcinomas by Regulating the Wnt/β-Catenin Signaling Pathway.; Authors - Liang Jiang ; KD Validated