ASPM Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASPM Polyclonal antibody (26223-1-AP)

• Featured Product
• KD/KO Validated

ASPM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26223-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ASP, Asp homolog, ASPM, Calmbp1, MCPH5

• 

  WB analysis using 26223-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26223-1-AP (ASPM antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 26223-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 26223-1-AP (ASPM antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26223-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 26223-1-AP (ASPM antibody), at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with alpha tubulin (66031-1-Ig, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASPM in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, K-562 cells
• Positive IHC detected in: human prostate cancer tissue, human gliomas tissue, human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26223-1-AP targets ASPM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24166

  Product name: Recombinant human ASPM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-95 aa of BC034607

  Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT

• Full Name: asp (abnormal spindle) homolog, microcephaly associated (Drosophila)
• Calculated Molecular Weight: 410 kDa or 218 kDa
• Observed Molecular Weight: 218 kDa
• GenBank Accession Number: BC034607
• Gene Symbol: ASPM
• Gene ID (NCBI): 259266
• RRID: AB_2880431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-ASPM antibody (Cat# 26223-1-AP) has 25 total citations published across journals including Science, Genome Biology, EMBO Journal, Cancer Letters, Cell Reports, Development, Journal of Biological Chemistry, and others. Research fields span cancer biology (lung, liver, colorectal, thyroid, ovarian, glioma, and prostate cancers), cell cycle regulation, spindle assembly, chromosome segregation, developmental biology, and oocyte biology. Applications include WB, IF, IHC, IP, and CoIP.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu
human	WB,IF	Exploration (Beijing); ASPM Induces Radiotherapy Resistance by Disrupting Microtubule Stability Leading to Chromosome Malsegregation in Non-Small Cell Lung Cancer.; Authors - Tao Zhong ; KD Validated
human	WB,IF	Cancer Lett; ZBTB20 promotes malignancy and stemness in lung squamous cell carcinoma through the transcriptional repression of KCTD1 and activation of Hedgehog signaling.; Authors - Hai Wang
human	WB,IHC,IF	Genome Biol; ASPM mediates nuclear entrapment of FOXM1 via liquid-liquid phase separation to promote progression of hepatocarcinoma; Authors - Xunliang Jiang ; KD Validated
mouse	IF	EMBO J; Binary organization of epidermal basal domains highlights robustness to environmental exposure; Authors - Sangeeta Ghuwalewala
	WB	Cell Rep; KIF18A promotes chromosome congression in cooperation with CENP-E downstream of CENP-C.; Authors - Jiahang Miao