Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

AP2B1 Polyclonal antibody

AP2B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Adaptor protein complex AP-2 subunit beta, Adaptor-related protein complex 2 subunit beta, ADTB2, AP 2 complex subunit beta, AP-2 complex subunit beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AP2B1 in ?

Tested Applications

Positive WB detected inHeLa cells, C6 cells, K-562 cells, SH-SY5Y cells, NIH/3T3 cells
Positive IP detected inK-562 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15690-1-AP targets AP2B1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8248

Product name: Recombinant human AP2B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 598-951 aa of BC006201

Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

Predict reactive species
Full Name adaptor-related protein complex 2, beta 1 subunit
Calculated Molecular Weight 105 kDa
Observed Molecular Weight 100-105 kDa
GenBank Accession NumberBC006201
Gene Symbol AP2B1
Gene ID (NCBI) 163
RRIDAB_2056351
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63010
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.

Protocols

Product Specific Protocols
IF protocol for AP2B1 antibody 15690-1-APDownload protocol
IHC protocol for AP2B1 antibody 15690-1-APDownload protocol
IP protocol for AP2B1 antibody 15690-1-APDownload protocol
WB protocol for AP2B1 antibody 15690-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-AP2A2 antibody (Cat# 15690-1-AP) has 18 citations across journals including Nature Communications, PNAS, Cell Death Discovery, Cell & Molecular Life Sciences, eLife, PLoS Pathogens, Journal of Virology, Virulence, iScience, and NPJ Parkinson's Disease. Research fields span viral entry mechanisms, endocytosis and vesicle trafficking, neurodegenerative diseases (ALS, Parkinson's, Alzheimer's), cancer biology, autophagy, and ubiquitination signaling.

SpeciesApplicationTitle
mouseWB

Nat Commun

Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis

Authors - Yesheng Fu
humanWB

J Exp Clin Cancer Res

GPAA1 promotes gastric cancer progression via upregulation of GPI-anchored protein and enhancement of ERBB signalling pathway.

Authors - Xiao-Xin Zhang
humanWB

Cell Death Discov

Digital color-coded molecular barcoding reveals dysregulation of common FUS and FMRP targets in soma and neurites of ALS mutant motoneurons

Authors - Maria Giovanna Garone
pigWB,IF

Sci China Life Sci

NPC1-regulated dynamic of clathrin-coated pits is essential for viral entry.

Authors - Guoli Li
humanWB

Proc Natl Acad Sci U S A

ATG9A-mediated plasma membrane repair is linked to Vps13A and regulated by glycosylation.

Authors - Natali H. Muskat
humanWB

NPJ Parkinsons Dis

Regulators of proteostasis are translationally repressed in fibroblasts from patients with sporadic and LRRK2-G2019S Parkinson's disease

Authors - Dani Flinkman
Loading...
||
New chat

Able™

正在加载,请稍候...