Tested Applications
| Positive WB detected in | HeLa cells, C6 cells, K-562 cells, SH-SY5Y cells, NIH/3T3 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15690-1-AP targets AP2B1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8248 Product name: Recombinant human AP2B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 598-951 aa of BC006201 Sequence: GSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN Predict reactive species |
| Full Name | adaptor-related protein complex 2, beta 1 subunit |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 100-105 kDa |
| GenBank Accession Number | BC006201 |
| Gene Symbol | AP2B1 |
| Gene ID (NCBI) | 163 |
| RRID | AB_2056351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63010 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AP2B1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AP2B1 antibody 15690-1-AP | Download protocol |
| IHC protocol for AP2B1 antibody 15690-1-AP | Download protocol |
| IP protocol for AP2B1 antibody 15690-1-AP | Download protocol |
| WB protocol for AP2B1 antibody 15690-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-AP2A2 antibody (Cat# 15690-1-AP) has 18 citations across journals including Nature Communications, PNAS, Cell Death Discovery, Cell & Molecular Life Sciences, eLife, PLoS Pathogens, Journal of Virology, Virulence, iScience, and NPJ Parkinson's Disease. Research fields span viral entry mechanisms, endocytosis and vesicle trafficking, neurodegenerative diseases (ALS, Parkinson's, Alzheimer's), cancer biology, autophagy, and ubiquitination signaling.
| Species | Application | Title |
|---|---|---|
Nat Commun Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis | ||
J Exp Clin Cancer Res GPAA1 promotes gastric cancer progression via upregulation of GPI-anchored protein and enhancement of ERBB signalling pathway. | ||
Cell Death Discov Digital color-coded molecular barcoding reveals dysregulation of common FUS and FMRP targets in soma and neurites of ALS mutant motoneurons | ||
Sci China Life Sci NPC1-regulated dynamic of clathrin-coated pits is essential for viral entry. | ||
Proc Natl Acad Sci U S A ATG9A-mediated plasma membrane repair is linked to Vps13A and regulated by glycosylation. | ||
NPJ Parkinsons Dis Regulators of proteostasis are translationally repressed in fibroblasts from patients with sporadic and LRRK2-G2019S Parkinson's disease |
