Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ANGPTL4 Polyclonal antibody

ANGPTL4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

angiopoietin like 4, Angiopoietin like protein 4, Angiopoietin related protein 4, Angiopoietin-like protein 4, Angiopoietin-related protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ANGPTL4 in ?

Tested Applications

Positive WB detected inmouse heart tissue, mouse kidney tissue, HEK-293 cells, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman kidney tissue, human oesophagus cancer tissue, human heart tissue, human ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells, HT-29 cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18374-1-AP targets ANGPTL4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13237

Product name: Recombinant human ANGPTL4 protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 1-374 aa of BC023647

Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL

Predict reactive species
Full Name angiopoietin-like 4
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC023647
Gene Symbol ANGPTL4
Gene ID (NCBI) 51129
RRIDAB_2878539
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BY76
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa.

Protocols

Product Specific Protocols
IF protocol for ANGPTL4 antibody 18374-1-APDownload protocol
IHC protocol for ANGPTL4 antibody 18374-1-APDownload protocol
IP protocol for ANGPTL4 antibody 18374-1-APDownload protocol
WB protocol for ANGPTL4 antibody 18374-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ANGPTL4 antibody (Cat# 18374-1-AP) has 63 total citations across journals including Cancer Cell, Nature Metabolism, Molecular Cancer, Journal of Clinical Investigation, EMBO Journal, FASEB Journal, and Journal of Advanced Research. Research fields span oncology (pancreatic, prostate, lung, melanoma, glioblastoma), fibrosis (pulmonary, renal, hepatic), cardiovascular disease, diabetes, obesity, neurodegeneration, ophthalmology, rheumatology, reproductive biology, aging, and environmental toxicology.

SpeciesApplicationTitle

Cancer Cell

Mapping cell type-resolved transcriptomic profiles to patient survival in pancreatic cancer.

Authors - Rong Tang

Mol Cancer

Targeting OxLDL-mediated CD36 + CAF reprogramming potentiates PD-1 immunotherapy in osteosarcoma

Authors - Anyu Zeng

Nat Metab

Resistant starch intake facilitates weight loss in humans by reshaping the gut microbiota

Authors - Huating Li
HumanIHC

Cancer Res

Retrodifferentiation of human tumor hepatocytes to stem cells leads to metabolic reprogramming and chemoresistance.

Authors - Karim Fekir
IF

J Adv Res

Maternal exposure to urban particulate matter induces cardiac developmental toxicity in zebrafish offspring by disrupting mitochondrial homeostasis

Authors - Shiqian Liu
humanWB

J Adv Res

Cancer-associated fibroblasts regulate mitochondrial metabolism and inhibit chemosensitivity via ANGPTL4-IQGAP1 axis in prostate cancer

Authors - Zhi Xiong

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 18374-1-AP was posted by Niklas Hartmann in November 2022. He rated the product 5 out of 5 stars and reported using it at a 1:350 dilution for immunofluorescence on human fibroblasts (lot 00039752). His comment described the staining as "bright and specific," indicating strong performance with clear signal and minimal background. Overall, the feedback is positive, highlighting reliable specificity and intensity for IF applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Niklas (Verified Customer) (11-28-2022)

bright and specific staining

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:350
  • Cell Tissue Type: human fibroblasts
Loading...
||
New chat

Able™

正在加载,请稍候...