AMPK Beta 1 Polyclonal antibody

• 

  WB analysis using 26907-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26907-1-AP (AMPK Beta 1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26907-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26907-1-AP (AMPK beta 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 26907-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26907-1-AP (AMPK beta 1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

AMPK Beta 1 Polyclonal Antibody for WB, ELISA

Cat No. 26907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PRKAB1, AMPKb, AMPK β, AMPK subunit beta-1, AMPK subunit beta 1

---

Tested Applications

• Positive WB detected in: A431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26907-1-AP targets AMPK Beta 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25534

  Product name: Recombinant human PRKAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC001056

  Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN

• Full Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC001056
• Gene Symbol: PRKAB1
• Gene ID (NCBI): 5564
• RRID: AB_2880679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).