Use Able AI chat for product recommendations

ALDH1L1 Polyclonal antibody

ALDH1L1 Polyclonal Antibody for WB, IHC, IF-Fro, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, IP, ELISA

10 FTHFDH, 10-FTHFDH, ALDH1L 1, Cytosolic 10-formyltetrahydrofolate dehydrogenase, EC:1.5.1.6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ALDH1L1 in ?

Tested Applications

Positive WB detected inmouse liver tissue, mouse liver, rat liver
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman gliomas tissue, rat liver tissue, rat pancreas tissue, human gliomas tissue, mouse brain tissue, human kidney tissue, mouse pancreas tissue, rat kidney tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17390-1-AP targets ALDH1L1 in WB, IHC, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11285

Product name: Recombinant human ALDH1L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 157-505 aa of BC027241

Sequence: DDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRAPPSPSTRPDPTAT

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member L1
Calculated Molecular Weight 99 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC027241
Gene Symbol ALDH1L1
Gene ID (NCBI) 10840
RRIDAB_2878401
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75891
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aldehyde dehydrogenase 1 family member L1 (ALDH1L1), belongs to the aldehyde dehydrogenase family of proteins and is responsible for formate oxidation in vivo. Loss of ALDH1L1 is associated with decreased apoptosis, increased cell motility, and cancer progression. ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 has some isoforms with MW of 99, 88 and 55 kDa.

Protocols

Product Specific Protocols
IF protocol for ALDH1L1 antibody 17390-1-APDownload protocol
IHC protocol for ALDH1L1 antibody 17390-1-APDownload protocol
IP protocol for ALDH1L1 antibody 17390-1-APDownload protocol
WB protocol for ALDH1L1 antibody 17390-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ALDH1L1 polyclonal antibody (Cat# 17390-1-AP) has 21 citations published in journals including Nature, Neuron, Nature Communications, Cell Reports, Cell Reports in Medicine, NPJ Parkinson's Disease, Journal of Neuroinflammation, Acta Pharmacologica Sinica, Brain Behavior and Immunity, Journal of Pineal Research, Neuroscience Bulletin, Cellular and Molecular Life Sciences, Neurobiology of Disease, World Allergy Organization Journal, Free Radical Research, Immunology and Ageing, Bioactive Materials, Gene, and Current Protocols. Associated research fields include neuroscience, neurodegeneration, immunology, oncology, and metabolic disease.

SpeciesApplicationTitle
mouseIF

Nature

Reversing a model of Parkinson's disease with in situ converted nigral neurons.

Authors - Hao Qian
mouseIF

Bioact Mater

Autologous exosome facilitates load and target delivery of bioactive peptides to repair spinal cord injury

Authors - Ning Ran
mouseWB,IHC

Nat Commun

Ten-eleven translocation 1 mediated-DNA hydroxymethylation is required for myelination and remyelination in the mouse brain.

Authors - Ming Zhang
WB

Neuron

Microglia regulate neuronal activity via structural remodeling of astrocytes

Authors - Ning Gu
mouseIF

Neuron

Astrocytic H3 receptors regulate anxiety through GABA signaling.

Authors - Yulan Li
mouse,humanWB,IF

Cell Rep Med

Phosphoglycerate kinase 1 contributes to diabetic kidney disease through enzyme-dependent and independent manners.

Authors - Hai-Jian Sun

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

One customer rated this product 4 out of 5 stars, using it at a 1:50 dilution for immunofluorescence on hiPSC-derived astrocytes. The reviewer described the result as "working fine," indicating satisfactory performance in their application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Juan (Verified Customer) (01-11-2022)

Working fine

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: hiPSC-derived astrocytes
ALDH1L1 Antibody Immunofluorescence validation (1:50 dilution) in hiPSC-derived astrocytes (Cat no:17390-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...