ALDH1B1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ALDH1B1 Polyclonal antibody (15560-1-AP)

ALDH1B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15560-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:1.2.1.3, ALDHX, ALDH5, Aldehyde dehydrogenase X, mitochondrial, Aldehyde dehydrogenase 5

• 

  WB analysis of HepG2 using 15560-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 15560-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15560-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 15560-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15560-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 15560-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 15560-1-AP (ALDH1B1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 15560-1-AP

  IP result of anti-ALDH1B1 (IP:15560-1-AP, 4ug; Detection:15560-1-AP 1:20000) with mouse brain tissue lysate 2100 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 15560-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15560-1-AP (ALDH1B1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 15560-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15560-1-AP (ALDH1B1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15560-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ALDH1B1 antibody (15560-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ALDH1B1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, K-562 cells, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15560-1-AP targets ALDH1B1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7144

  Product name: Recombinant human ALDH1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 168-517 aa of BC001619

  Sequence: FCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

• Full Name: aldehyde dehydrogenase 1 family, member B1
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC001619
• Gene Symbol: ALDH1B1
• Gene ID (NCBI): 219
• RRID: AB_2224162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30837
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.(PMID:21216231). ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung(PMID:18611112).

Publications

What published studies show

ALDH1B1 Polyclonal antibody (Cat# 15560-1-AP) has 24 citations published in journals including Nature Communications, Molecular Cell, Advanced Science, Oncogene, Apoptosis, BMC Cancer, iScience, eLife, Journal of Pathology, and International Journal of Molecular Sciences. Associated research fields span cancer biology (pancreatic, glioblastoma, ovarian, endometrial, and colonic cancers), liver disease (alcoholic liver injury, steatohepatitis), aldehyde and retinoic acid metabolism, mitochondrial dysfunction, skeletal muscle physiology, virology, and pharmacology.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF	Nat Commun; Compression-induced NF-κB activation sustains tumor cell survival in confinement by detoxifying aldehydes and promotes metastasis.; Authors - Bing Liu ; KD Validated
mouse	WB	Mol Cell; Maternal Aldehyde Elimination during Pregnancy Preserves the Fetal Genome.; Authors - Nina Oberbeck
		Adv Sci (Weinh); BIN1 and ALDH1B1 Deficiency in Colonic Smooth Muscle Drives Mitochondrial Dysfunction and Fibrosis in Slow-Transit Constipation.; Authors - Jianbo Liu
mouse	IHC	J Transl Med; Identification and experimental validation of KMO as a critical immune-associated mitochondrial gene in unstable atherosclerotic plaque; Authors - Fu-Jun Liao
mouse	IHC	Oncogene; Lfng-expressing centroacinar cell is a unique cell-of-origin for p53 deficient pancreatic cancer; Authors - Wen-Cheng Chung
human	IHC	Apoptosis; Metabolism-related ALDH1B1 acts as potential predictor and therapeutic target for primary gastrointestinal diffuse large B-cell lymphoma; Authors - Qiqi Qiao