Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ALDH1A1 Monoclonal antibody, PBS Only

ALDH1A1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 60171-1-PBS
Clone No. 1A10A2
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

1A10A2, 3-deoxyglucosone dehydrogenase, ALDC, Aldehyde dehydrogenase 1A1, ALDH 1A1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ALDH1A1 in ?

Product Information

60171-1-PBS targets ALDH1A1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8551

Product name: Recombinant human ALDH1A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 153-501 aa of BC001505

Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member A1
Calculated Molecular Weight 501 aa, 55 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC001505
Gene Symbol ALDH1A1
Gene ID (NCBI) 216
RRIDAB_10693634
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00352
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1A1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001).

Loading...
||
New chat

Able™

正在加载,请稍候...