Tested Applications
| Positive WB detected in | L02 cells, mouse cerebellum tissue, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human lung squamous cell carcinoma tissue, human heart tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13989-1-AP targets ACSL1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5059 Product name: Recombinant human ACSL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 349-698 aa of BC050073 Sequence: RLLMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKVQSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV Predict reactive species |
| Full Name | acyl-CoA synthetase long-chain family member 1 |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 68 kDa, 78 kDa |
| GenBank Accession Number | BC050073 |
| Gene Symbol | ACSL1 |
| Gene ID (NCBI) | 2180 |
| RRID | AB_2257870 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P33121 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACSL1(Long-chain-fatty-acid--CoA ligase 1) is also named as FACL1, FACL2, LACS, LACS1, LACS2 and belongs to the ATP-dependent AMP-binding enzyme family. ACSL1 is a 75 kDa protein that is associated peripherally with the plasma membrane(Brian M Wiczer, etc., 2006). ACSL1 is abundantly expressed in tissues, such as liver and brown fat, that metabolize substantial amounts of triglycerides as fuel, and as such, a deficiency in ACSL1 function could have a more profound affect in those cells, resulting in hepatosteatosis and potentially increased very low density lipoprotein production by the liver or decreased thermogenic capacity in brown adipose tissue(PMID:19429676). An anti-rat ACSL1 antibody recognized a band of the predicted 68 kDa in high-speed supernatant from rat liver and in human and murine SMCs, monocyte-derived macrophages, and murine peritoneal macrophages (PMID:17259370). It has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACSL1 antibody 13989-1-AP | Download protocol |
| IHC protocol for ACSL1 antibody 13989-1-AP | Download protocol |
| IP protocol for ACSL1 antibody 13989-1-AP | Download protocol |
| WB protocol for ACSL1 antibody 13989-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ACSL1 antibody (Cat# 13989-1-AP) has accumulated 91 citations across high-impact journals including Nature, Cell Metabolism, Nature Cancer, Nature Metabolism, Nature Cell Biology, Nature Communications, Molecular Cell, Cancer Research, Hepatology, and Cell Reports. Citations span diverse research fields such as lipid metabolism, ferroptosis, hepatocellular carcinoma, obesity, nonalcoholic fatty liver disease, mitochondrial homeostasis, fatty acid oxidation, neuroinflammation, and metabolic reprogramming in cancer.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Albumosomes formed by cytoplasmic pre-folding albumin maintain mitochondrial homeostasis and inhibit nonalcoholic fatty liver disease | ||
Cell Metab Oncogenic fatty acid oxidation senses circadian disruption in sleep-deficiency-enhanced tumorigenesis | ||
Nat Cancer SCRN1 confers hepatocellular carcinoma resistance to ferroptosis by stabilizing GPX4 via STK38-mediated phosphorylation. | ||
Nat Metab N6-methyladenosine (m6A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation | ||
Nat Cell Biol Functional multi-organelle units control inflammatory lipid metabolism of macrophages |
Reviews
What customers say
All three reviewers gave 5-star ratings. The antibody was used successfully across multiple applications: immunofluorescence on human iPSC-derived microglia at 1:500 dilution, immunohistochemistry on liver tissue at 1:100, and Western blot/immunoprecipitation on rat heart at 1:2000. Reviewers described it as a "great antibody for ICC in immune cells," called it the "best product," and praised both the antibody quality and customer service. Overall, users report reliable performance across species and applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christin (Verified Customer) (12-22-2025) | Great antibody for ICC in immune cells
|
MALLIKARJUNA (Verified Customer) (10-24-2025) | BEST PRODUCT
|
Thomas (Verified Customer) (10-23-2019) | Very good service, very good antibody
|
