ACOX1 Recombinant monoclonal antibody

• 

  WB analysis using 83731-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83731-1-RR (ACOX1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovarian cancer using 83731-1-RR

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 83731-1-RR (ACOX1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 83731-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using AOX antibody (83731-1-RR, Clone: 240754D3 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 83731-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83731-1-RR against Human ACOX1 were performed. The affinity constant is 0.777 nM.

ACOX1 Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83731-1-RR

Clone No.240754D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Palmitoyl-CoA oxidase, EC:1.3.3.6, AOX, ACOX 1, ACOX

---

Tested Applications

• Positive WB detected in: HuH-7 cells, HepG2 cells
• Positive IHC detected in: human ovarian cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83731-1-RR targets ACOX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1405

  Product name: Recombinant human AOX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-660 aa of BC010425

  Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL

• Full Name: acyl-Coenzyme A oxidase 1, palmitoyl
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 70-74 kDa, 22 kDa
• GenBank Accession Number: BC010425
• Gene Symbol: ACOX1
• Gene ID (NCBI): 51
• RRID: AB_3671330
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15067
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).