Aconitase 2 Polyclonal antibody

Aconitase 2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11134-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

ACO2, ACO 2, EC:4.2.1.3, Citrate hydro-lyase, Aconitase2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human liver tissue, human skeletal muscle tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
Positive IHC detected inmouse kidney tissue, human colon tissue, human lung cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:200-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11134-1-AP targets Aconitase 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1590

Product name: Recombinant human ACO2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-306 aa of BC014092

Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY

Predict reactive species
Full Name aconitase 2, mitochondrial
Calculated Molecular Weight 85 kDa
Observed Molecular Weight 85 kDa
GenBank Accession NumberBC014092
Gene Symbol ACO2
Gene ID (NCBI) 50
RRIDAB_2289288
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99798
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).

Protocols

Product Specific Protocols
WB protocol for Aconitase 2 antibody 11134-1-APDownload protocol
IHC protocol for Aconitase 2 antibody 11134-1-APDownload protocol
IF protocol for Aconitase 2 antibody 11134-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Malic enzyme 2 connects the Krebs cycle intermediate fumarate to mitochondrial biogenesis.

Authors - Yi-Ping Wang
mouseWB

Aging Dis

Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging

Authors - Minghao Yuan
ratWB,IF

Sci Total Environ

TRIM24-DTNBP1-ATP7A mediated astrocyte cuproptosis in cognition and memory dysfunction caused by Y2O3 NPs

Authors - Ziwei Chen
humanWB

Cell Rep

A LON-ClpP Proteolytic Axis Degrades Complex I to Extinguish ROS Production in Depolarized Mitochondria.

Authors - Kenneth Robert Pryde
humanWB

EMBO Rep

UBXN1 maintains ER proteostasis and represses UPR activation by modulating translation

Authors - Brittany A Ahlstedt
humanWB

Cell Biosci

Hinokitiol-iron complex is a ferroptosis inducer to inhibit triple-negative breast tumor growth

Authors - Hongting Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
FH

Svitlana (Verified Customer) (03-19-2019)

SDS-PAGE: mitochondrial lysate 10 ug protein/well, 4-12% Bis-Tris.Transfer: Immobilon-FL transfer membranes O/N at 30V, 4CBlocking: SEA Block Blocking Buffer 1h at room temperature.Secondary Ab: IRDye 800CW Goat anti-Rabbit 1 h at room temperature.Lines on WB:1. BioRad Precision Plus Protein standard2. Lysate of mitochondrial fraction.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293t mitochondria
Aconitase 2 Antibody Western Blot, validation (1:1000 dilution) in HEK293t mitochondria (Cat no:11134-1-AP)
Loading...