Tested Applications
| Positive WB detected in | mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue |
| Positive IHC detected in | mouse kidney tissue, human colon tissue, human lung cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11134-1-AP targets Aconitase 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1590 Product name: Recombinant human ACO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC014092 Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKY Predict reactive species |
| Full Name | aconitase 2, mitochondrial |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | 85 kDa |
| GenBank Accession Number | BC014092 |
| Gene Symbol | ACO2 |
| Gene ID (NCBI) | 50 |
| RRID | AB_2289288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99798 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACO2(aconitate hydratase, mitochondrial) is also named as citrate hydro-lyase and belongs to the aconitase/IPM isomerase family. It plays a key function in cellular energy production, and loss of its activity has a major impact on cellular and organismal survival. Western blot shows two bands of 83 kDa and 40 kDa. The 40 kDa fragment decreases with age and oxidative stress, whereas other fragmentation products with molecular weights between 40 and 83 kDa increased with age and MnSOD(mitochondrial manganese superoxide dismutase) deficiency(PMID:12459471). Defects in ACO2 are the cause of infantile cerebellar-retinal degeneration (ICRD).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Aconitase 2 antibody 11134-1-AP | Download protocol |
| IHC protocol for Aconitase 2 antibody 11134-1-AP | Download protocol |
| WB protocol for Aconitase 2 antibody 11134-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Aconitase 2 (ACO2) antibody (Cat# 11134-1-AP) has accumulated 45 citations published in journals including Nature, Circulation, Cell Metabolism, Nature Cell Biology, Cancer Research, Nature Communications, Molecular Cell, Cell Reports, EMBO Reports, and ACS Nano. Associated research fields encompass mitochondrial biology, TCA cycle metabolism, iron homeostasis, cuproptosis and ferroptosis, cancer, neurodegenerative diseases (Alzheimer's, Huntington's), diabetes, and inflammation.
| Species | Application | Title |
|---|---|---|
Circulation Nuclear Receptor NR1D1 Regulates Abdominal Aortic Aneurysm Development by Targeting the Mitochondrial Tricarboxylic Acid Cycle Enzyme Aconitase-2
| ||
Cell Metab Malic enzyme 2 connects the Krebs cycle intermediate fumarate to mitochondrial biogenesis. | ||
Cancer Res miR-450a acts as a tumor suppressor in ovarian cancer by regulating energy metabolism. | ||
Nat Commun Mammalian SLC39A13 promotes ER/Golgi iron transport and iron homeostasis in multiple compartments |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported positive results. One user achieved good performance at a 1:500 dilution on mouse brain tissue and rated it 4 out of 5 stars. The other user obtained clear results at 1:1000 dilution on HEK293t mitochondrial lysate using an Immobilon-FL membrane with IRDye 800CW secondary antibody, rating it 5 out of 5 stars. Overall, the antibody is well-received for WB applications across different species and dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|
Svitlana (Verified Customer) (03-19-2019) | SDS-PAGE: mitochondrial lysate 10 ug protein/well, 4-12% Bis-Tris.Transfer: Immobilon-FL transfer membranes O/N at 30V, 4CBlocking: SEA Block Blocking Buffer 1h at room temperature.Secondary Ab: IRDye 800CW Goat anti-Rabbit 1 h at room temperature.Lines on WB:1. BioRad Precision Plus Protein standard2. Lysate of mitochondrial fraction.
 |
