ACE2 Recombinant monoclonal antibody

• 

  IHC staining of human kidney using 80063-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 80063-1-RR (ACE2 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 80063-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 80063-1-RR (ACE2 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human kidney using 80063-1-RR

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using ACE2 antibody (80063-1-RR, Clone: 4H12 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ACE2 Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 80063-1-RR

Clone No.4H12

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IHC, IF-P, ELISA

Synonyms

ACE related carboxypeptidase, ACE2, ACEH, DKFZp434A014, Metalloprotease MPROT15

---

Tested Applications

• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:800-1:3200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80063-1-RR targets ACE2 in IHC, IF-P, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30683

  Product name: Recombinant human ACE2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 30-356 aa of BC048094

  Sequence: DKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF

• Full Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
• Calculated Molecular Weight: 805 aa, 92 kDa
• GenBank Accession Number: BC048094
• Gene Symbol: ACE2
• Gene ID (NCBI): 59272
• RRID: AB_2918860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088). 80063-1-RR is specific for ACE2, and its antigen region is 30-356aa.