ACE Polyclonal antibody

• 

  WB analysis of mouse heart using 24743-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24743-1-AP (ACE Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lung using 24743-1-AP

  rat lung tissue were subjected to SDS PAGE followed by western blot with 24743-1-AP (ACE antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat lung using 24743-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 24743-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 24743-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 24743-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 24743-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24743-1-AP (ACE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ACE Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24743-1-AP

Publications(36)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

DCP1, DCP, Angiotensin-converting enzyme, soluble form, Angiotensin-converting enzyme, Angiotensin converting enzyme

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IHC detected in: rat lung tissue, human lung tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 24 publications below
• IHC: See 9 publications below
• IF: See 3 publications below
• CoIP: See 1 publications below

Product Information

24743-1-AP targets ACE in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20654

  Product name: Recombinant human ACE protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 390-739 aa of BC036375

  Sequence: FYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYMSKRAASSGPPGSPKLPPAAQGHGEVPVHDLLWHPGPPV

• Full Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
• Calculated Molecular Weight: 150 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC036375
• Gene Symbol: ACE
• Gene ID (NCBI): 1636
• RRID: AB_2879701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12821
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACE(Angiotensin-converting enzyme) is also named as DCP, DCP1 and belongs to the peptidase M2 family. It is involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE also has a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. It has 4 isoforms produced by alternative splicing. The full length protein has 15 glycosylation sites and it can show a molecular weight of 170 kDa(PMID:16804085).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,rat	WB,IHC	Oxid Med Cell Longev; Tissue Renin-Angiotensin System (tRAS) Induce Intervertebral Disc Degeneration by Activating Oxidative Stress and Inflammatory Reaction.; Authors - Kaiqiang Sun
mouse	IHC	J Med Chem; Hypoxia Activated Nitric Oxide Donor Compounds for the Prevention and Treatment of Myocardial Hypoxia-Induced Injury; Authors - Wanxiang Yang
rat	IHC	J Cell Mol Med; PMID: 32073745; Authors - Jianxia Wen
mouse	WB	Diabetol Metab Syndr; Celastrol attenuates streptozotocin-induced diabetic cardiomyopathy in mice by inhibiting the ACE / Ang II / AGTR1 signaling pathway; Authors - Xuyong Zhao
rat	WB	Am J Physiol Renal Physiol; Adequate salt intake is essential for candesartan-treated rats to maintain renal function; Authors - Anni Xie
mouse	IHC,WB	ACS Omega; Azelaic Acid Regulates the Renin-Angiotensin System and Improves Colitis Based on Network Pharmacology and Experimentation; Authors - Yangjie Liao