ACC1 Polyclonal antibody

• 

  WB analysis using 21923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21923-1-AP (ACC1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21923-1-AP

  WB result of ACC1 antibody (21923-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACC1 transfected HeLa cells.

• 

  WB analysis using 21923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21923-1-AP (ACC1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21923-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21923-1-AP (ACC1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 21923-1-AP

  IP result of anti-ACC1 (IP:21923-1-AP, 4ug; Detection:21923-1-AP 1:2000) with HepG2 cells lysate 1800 ug.

• 

  IHC staining of mouse skeletal muscle using 21923-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 21923-1-AP (ACC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21923-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21923-1-AP (ACC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 21923-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 21923-1-AP (ACC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21923-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ACC1 antibody (21923-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ACC1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21923-1-AP

Publications(185)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

ACACA, ACAC, ACC, ACCA, ACC-alpha

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: mouse skeletal muscle tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:20000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 170 publications below
• IHC: See 15 publications below
• IF: See 9 publications below
• IP: See 2 publications below
• RIP: See 1 publications below

Product Information

21923-1-AP targets ACC1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16452

  Product name: Recombinant human ACC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2260-2383 aa of BC137287

  Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST

• Full Name: acetyl-Coenzyme A carboxylase alpha
• Calculated Molecular Weight: 2383 aa, 275 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC137287
• Gene Symbol: Acetyl-CoA Carboxylase 1
• Gene ID (NCBI): 31
• RRID: AB_11042445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13085
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy; Authors - Jiacheng Guo
human	WB	Cell Res; Mannose antagonizes GSDME-mediated pyroptosis through AMPK activated by metabolite GlcNAc-6P; Authors - Yuan-Li Ai
human	WB	Signal Transduct Target Ther; The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease; Authors - Chandana Thimme Gowda
mouse	WB	Cell Metab; Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.; Authors - Yi Fu
human,mouse	WB	Adv Sci (Weinh); Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells; Authors - Ling Li
mouse	WB	Autophagy; Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway; Authors - Meng Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kishor (Verified Customer) (02-22-2019)

I have got some good results with this Ab, but the band are not at the exact place (molecular weight) where it supposed to be

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000

ACC1 Antibody Western Blot, validation (1:1000 dilution) in (Cat no:21923-1-AP)