Tested Applications
| Positive WB detected in | Caco-2 cells, HepG2 cells, mouse colon tissue, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 42 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
27722-1-AP targets ABCG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26844 Product name: Recombinant human ABCG5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of NM_022436 Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL Predict reactive species |
| Full Name | ATP-binding cassette, sub-family G (WHITE), member 5 |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 68 kDa~72 kDa |
| GenBank Accession Number | NM_022436 |
| Gene Symbol | ABCG5 |
| Gene ID (NCBI) | 64240 |
| RRID | AB_2880952 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H222 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ABCG5 antibody 27722-1-AP | Download protocol |
| WB protocol for ABCG5 antibody 27722-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Diabetes Long Noncoding RNA lncRHL Regulates Hepatic VLDL Secretion by Modulating hnRNPU/ BMAL1/MTTP Axis. | ||
Cell Mol Gastroenterol Hepatol A Mitochondrial DNA Variant Elevates the Risk of Gallstone Disease by Altering Mitochondrial Function. | ||
Mol Ther Nucleic Acids HFD-induced TRAF6 upregulation promotes liver cholesterol accumulation and fatty liver development via EZH2-mediated miR-429/PPARα axis. | ||
Chin Med ZeXieYin formula alleviates atherosclerosis by regulating SBAs levels through the FXR/FGF15 pathway and restoring intestinal barrier integrity | ||
J Cell Mol Med The marine-derived furanone reduces intracellular lipid accumulation in vitro by targeting LXRα and PPARα. | ||
Front Nutr Preparation of microgel co-loaded with nuciferine and epigallocatechin-3-gallate for the regulation of lipid metabolism |















