ABCG5 Polyclonal antibody

• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27722-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 27722-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 27722-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 27722-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27722-1-AP (ABCG5 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 27722-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27722-1-AP (ABCG5 antibody) at dilution of 1:200 (under 40x lens).

ABCG5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27722-1-AP

Publications(40)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Sterolin 1, STSL

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HepG2 cells, mouse colon tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 38 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

27722-1-AP targets ABCG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26844

  Product name: Recombinant human ABCG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of NM_022436

  Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 5
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 68 kDa~72 kDa
• GenBank Accession Number: NM_022436
• Gene Symbol: ABCG5
• Gene ID (NCBI): 64240
• RRID: AB_2880952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Diabetes; Long Noncoding RNA lncRHL Regulates Hepatic VLDL Secretion by Modulating hnRNPU/ BMAL1/MTTP Axis.; Authors - Xuan Shen
human	WB	Cell Mol Gastroenterol Hepatol; A Mitochondrial DNA Variant Elevates the Risk of Gallstone Disease by Altering Mitochondrial Function.; Authors - Dayan Sun
human	WB	Mol Ther Nucleic Acids; HFD-induced TRAF6 upregulation promotes liver cholesterol accumulation and fatty liver development via EZH2-mediated miR-429/PPARα axis.; Authors - Zhi Zhang
human	WB	J Cell Mol Med; The marine-derived furanone reduces intracellular lipid accumulation in vitro by targeting LXRα and PPARα.; Authors - Ting Li
rat	WB	Front Nutr; Preparation of microgel co-loaded with nuciferine and epigallocatechin-3-gallate for the regulation of lipid metabolism; Authors - Shengnan Zhu
mouse,human	WB	Biochem Pharmacol; Resveratrol enhances trans-intestinal cholesterol excretion through selective activation of intestinal liver X receptor alpha.; Authors - Juan Pang