ABCG5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ABCG5 Polyclonal antibody (27722-1-AP)

ABCG5 Polyclonal Antibody for WB, ELISA

Cat No. 27722-1-AP Copied!

Publications (57)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Sterolin 1, STSL

• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 27722-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 27722-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 27722-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27722-1-AP (ABCG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ABCG5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HepG2 cells, mouse colon tissue, mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27722-1-AP targets ABCG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26844

  Product name: Recombinant human ABCG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-85 aa of NM_022436

  Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL

• Full Name: ATP-binding cassette, sub-family G (WHITE), member 5
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 68 kDa~72 kDa
• GenBank Accession Number: NM_022436
• Gene Symbol: ABCG5
• Gene ID (NCBI): 64240
• RRID: AB_2880952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABCG5 belongs to the ABC transporter subfamily, whose members are "half-transporters" that require the formation of homodimers or heterodimers to function(PMID: 14504269). ABCG5 and ABCG8 form an obligate heterodimer that limits intestinal absorption and facilitates biliary secretion of cholesterol and phytosterols(PMID: 24252657). Mutations in ABCG5e may contribute to sterol accumulation and atherosclerosis(PMID: 15054092).

Publications

What published studies show

ABCG5 Polyclonal antibody (Cat# 27722-1-AP) has 57 citations published in journals including Nature, Cell Reports, Molecular Therapy, Phytomedicine, Journal of Agricultural and Food Chemistry, Nutrients, Diabetes, Acta Pharmaceutica Sinica B, and others. Associated research fields encompass cholesterol and lipid metabolism, gallstone formation, atherosclerosis, bile acid metabolism, reverse cholesterol transport, hypercholesterolemia, hepatic fibrosis, steatohepatitis, and metabolic syndrome.

Automatically generated from the 57 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Inhibition of ASGR1 decreases lipid levels by promoting cholesterol excretion; Authors - Ju-Qiong Wang
human	WB	Clin Mol Hepatol; GOLM1 promotes cholesterol gallstone formation via ABCG5-mediated cholesterol efflux in MASH livers; Authors - Yi-Tong Li
mouse	WB	Acta Pharm Sin B; Intestinal epithelial cell NCoR deficiency ameliorates obesity and metabolic syndrome; Authors - Shaocong Hou
mouse	WB	Cell Death Dis; Apolipoprotein O modulates cholesterol metabolism via NRF2/CYB5R3 independent of LDL receptor; Authors - Jin Chen
mouse	WB	Int J Biol Sci; miRNA-223 Suppresses Mouse Gallstone Formation by Targeting Key Transporters in Hepatobiliary Cholesterol Secretion Pathway.; Authors - Feng Zhao
		Mol Ther; Precise hepatic base editing of ASGR1 enables robust and durable LDLR-independent lipid lowering in vivo.; Authors - Yaofeng Hou