Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SGK3 Polyclonal antibody

SGK3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

SGKL, SGK 3, Serum/glucocorticoid regulated kinase-like isoform 1 variant, CISK

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SGK3 in ?

Tested Applications

Positive WB detected inHeLa cells, A375 cells, human liver tissue, mouse skin tissue, rat kidney tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman pancreas cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12699-1-AP targets SGK3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3149

Product name: Recombinant human SGK3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-496 aa of BC015326

Sequence: TDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

Predict reactive species
Full Name serum/glucocorticoid regulated kinase family, member 3
Calculated Molecular Weight 496 aa, 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC015326
Gene Symbol SGK3
Gene ID (NCBI) 23678
RRIDAB_2188548
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53EW6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serum- and glucocorticoid-inducible kinase 3 (SGK3) is a protein kinase of the AGC family of protein kinase A, protein kinase G, and protein kinase C and functions downstream of phosphatidylinositol 3-kinase (PI3K)(PMID:21084382). It is also named as DKFZp781N0293, CISK, SGK2, SGKL and may be involved in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. SGK3 mediates cell IL-3-dependent survival signals (PMID:12397388). SGK3 has 2 isoforms produced by alternative splicing with the molecular weight of 57 kDa and 53 kDa.

Protocols

Product Specific Protocols
IF protocol for SGK3 antibody 12699-1-APDownload protocol
IHC protocol for SGK3 antibody 12699-1-APDownload protocol
IP protocol for SGK3 antibody 12699-1-APDownload protocol
WB protocol for SGK3 antibody 12699-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SGK3 Polyclonal antibody (Cat# 12699-1-AP) has 3 citations published in Autophagy, Frontiers in Pharmacology, and Frontiers in Cell and Developmental Biology. The associated research fields include chronic stress-induced neurogenesis decline, the SGK3/TOPK signaling pathway in acute-to-chronic kidney disease transition, and cell heterogeneity in acute ischemic stroke. Applications cited include WB, IHC, and IF, with reactivity in mouse and rat.

SpeciesApplicationTitle
mouseWB

Autophagy

Autophagic death of neural stem cells mediates chronic stress-induced decline of adult hippocampal neurogenesis and cognitive deficits.

Authors - Seonghee Jung
  • KO Validated
mouse,ratWB,IHC,IF

Front Pharmacol

The role of the SGK3/TOPK signaling pathway in the transition from acute kidney injury to chronic kidney disease

Authors - Huapan Shu
  • KD Validated
mouseIF

Front Cell Dev Biol

Single-Cell RNA Sequencing With Combined Use of Bulk RNA Sequencing to Reveal Cell Heterogeneity and Molecular Changes at Acute Stage of Ischemic Stroke in Mouse Cortex Penumbra Area.

Authors - Kang Guo
Loading...
||
New chat

Able™

正在加载,请稍候...