PI3 Kinase p55 Gamma Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PI3 Kinase p55 Gamma Polyclonal antibody (27035-1-AP)

• Featured Product
• KD/KO Validated

PI3 Kinase p55 Gamma Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27035-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

PIK3R3, p55, p55 GAMMA, p55PIK, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma

• 

  WB analysis of MCF-7 using 27035-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27035-1-AP (PI 3 Kinase p55 gamma antibody at dilution of 1:1000 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 27035-1-AP

  WB result of PI 3 Kinase p55 gamma antibody (27035-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PI 3 Kinase p55 gamma transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HUVEC using 27035-1-AP

  WB result of PIK3R3 antibody (27035-1-AP) on whole cell extract from HUVEC targeted by shRNAs (#1, #2) or a control shRNA (NT). (Data from Dr. Fuqiang Geng, Weill Cornell Medical College).

• 

  IHC staining of human kidney using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27035-1-AP (PI 3 Kinase p55 gamma antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27035-1-AP (PI 3 Kinase p55 gamma antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 27035-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 27035-1-AP (PI3 Kinase p55 Gamma antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HUVEC cells, HEK-293 cells
• Positive IHC detected in: human kidney tissue, mouse testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27035-1-AP targets PI3 Kinase p55 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25884

  Product name: Recombinant human PIK3R3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-382 aa of BC021622

  Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI

• Full Name: phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
• Calculated Molecular Weight: 85 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC021622
• Gene Symbol: PI3 Kinase p55 Gamma
• Gene ID (NCBI): 8503
• RRID: AB_2880730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92569
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Clinical significance and potential molecular mechanisms of SYT15 expression in lung adenocarcinoma.; Authors - Mei Tian
human	IHC	Mol Oncol; Consensus molecular subtyping of colorectal carcinoma brain metastases reveals a metabolic signature associated with poor patient survival; Authors - Barnabas Irmer
rat	WB	World J Mens Health; Relaxin-2 Prevents Erectile Dysfunction by Cavernous Nerve, Endothelial and Histopathological Protection Effects in Rats with Bilateral Cavernous Nerve Injury; Authors - Kang Liu
mouse,human	WB,IHC	BMC Cancer; Circ_0021350 plays an oncogene role by regulating miR-1207-3p/PIK3R3 in glioblastoma; Authors - Cheng Tan ; KD Validated
human	WB	J Biol Chem; Adenovirus E4ORF1 activates isoform-specific phosphatidylinositol 3-kinase signaling in human endothelial cells.; Authors - Fuqiang Geng
human	IHC	Am J Physiol Lung Cell Mol Physiol; p55PIK Deficiency and its N-terminal Derivative inhibit Inflammation and Emphysema in COPD mouse model.; Authors - Ting Wang