NFIX Monoclonal antibody

• Home
• Products
• Primary Antibodies
• NFIX Monoclonal antibody (67983-1-Ig)

NFIX Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67983-1-Ig Copied!

Clone No. 1E8A1

Publications (4)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, ELISA

Synonyms

1E8A1, CCAAT-box-binding transcription factor, CTF, NF1-X, NF-I/X

• 

  WB analysis using 67983-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 67983-1-Ig

  rat testis tissue were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 67983-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67983-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 67983-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 67983-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67983-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67983-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NFIX in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig brain tissue, A549 cells, HeLa cells, rat testis tissue, rat brain tissue, rabbit brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67983-1-Ig targets NFIX in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31447

  Product name: Recombinant human NFIX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-400 aa of NM_001271043

  Sequence: ADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL

• Full Name: nuclear factor I/X (CCAAT-binding transcription factor)
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 45kDa, 50kDa
• GenBank Accession Number: NM_001271043
• Gene Symbol: NFIX
• Gene ID (NCBI): 4784
• RRID: AB_2918732
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14938
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFIX, also named CTF, belongs to the CTF/NF-I family. NFIX recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. NFIX is individually capable of activating transcription and replication.

Publications

What published studies show

NFIX Monoclonal antibody (1E8A1), catalog number 67983-1-Ig, has a total of 4 citations. These appear in Cell, Immunity, Science Advances, and Smart Medicine. The associated research fields include esophageal squamous cell carcinoma, ferroptosis and allergic airway inflammation, epitranscriptomics and hematopoietic stem cell fate determination, and NFIX-mediated transcriptional regulation in skeletal muscle.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell; Targeting TFAP2β condensation suppresses the development of esophageal squamous cell carcinoma; Authors - Zhaomin Deng
human	WB	Immunity; Tolerance to ferroptosis facilitates lipid metabolism and pathogenic type 2 immunity in allergic airway inflammation; Authors - Chantal Wientjens
mouse	WB	Sci Adv; Nat10-mediated ac4C epitranscriptomics orchestrates hematopoietic stem/progenitor cell fate determination via translation control.; Authors - Feng Huang
human	WB	Smart Med; Mechanistic Insights Into NFIX-Mediated DNA Recognition and Transcriptional Regulation in Skeletal Muscle.; Authors - Ci Zhu ; KD Validated