CD24 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD24 Polyclonal antibody (10600-1-AP)

CD24 Polyclonal Antibody for WB, ELISA

Cat No. 10600-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

CD24A

• 

  WB analysis using 10600-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10600-1-AP (CD24 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 10600-1-AP

  WB result of CD24 antibody (10600-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD24 transfected Raji cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10600-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10600-1-AP (CD24 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD24 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Daudi cells, mouse brain tissue, Raji cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10600-1-AP targets CD24 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0654

  Product name: Recombinant human CD24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC007674

  Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

• Full Name: CD24 molecule
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 30-70 kDa
• GenBank Accession Number: BC007674
• Gene Symbol: CD24
• Gene ID (NCBI): 100133941
• RRID: AB_10646440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25063
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)

Publications

What published studies show

Anti-CD24 antibody (Cat# 10600-1-AP) has accumulated 26 citations published in journals including Nature Microbiology, Nature Communications, Advanced Science, Cancer Letters, International Journal of Biological Sciences, Apoptosis, eLife, and BMC Cancer. Associated research fields span oncology (breast, colorectal, esophageal, melanoma, cervical, pancreatic, lung, and kidney cancers), tumor metastasis, cancer stemness, immune microenvironment, infectious disease, neuroscience, and regenerative medicine.

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Microbiol; Uropathogenic Escherichia coli invade luminal prostate cells via FimH-PPAP receptor binding.; Authors - Maria Guedes
human	IF	Nat Commun; Natural photosynthetic system for restoring homeostasis of animal organelle interaction network.; Authors - Chen Xia
human		Exp Mol Med; SLC38A4 promotes Kupffer cell phagocytosis and suppresses tumor liver metastasis.; Authors - Jie Li
human		Adv Sci (Weinh); A Novel Long Non-Coding RNA lnc030 Maintains Breast Cancer Stem Cell Stemness by Stabilizing SQLE mRNA and Increasing Cholesterol Synthesis.; Authors - Yilu Qin
human	IF	Adv Sci (Weinh); Single‐Cell Transcriptome Profiling Reveals Multicellular Ecosystem of Nucleus Pulposus during Degeneration Progression; Authors - Ji Tu
human	WB	Cancer Lett; CD24 promotes metastasis and chemoresistance by directly targeting Arf6-ERK pathway in esophageal squamous cell carcinoma.; Authors - Pan Hong ; KD Validated