BAK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BAK Polyclonal antibody (29552-1-AP)

• Featured Product
• KD/KO Validated

BAK Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 29552-1-AP Copied!

Publications (43)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

BAK1, Bcl-2 homologous antagonist/killer, Bcl2-L-7, Bcl-2-like protein 7, CDN1

• 

  WB analysis using 29552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 29552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29552-1-AP (BAK antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 29552-1-AP

  WB result of BAK antibody (29552-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-BAK transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A431 using 29552-1-AP

  IP result of anti-BAK (IP:29552-1-AP, 4ug; Detection:29552-1-AP 1:3000) with A431 cells lysate 1040 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 29552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 29552-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 29552-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29552-1-AP (BAK antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 29552-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using BAK antibody (29552-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BAK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, Neuro-2a cells, HEK-293 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, 4T1 cells, ROS1728 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human colon cancer tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29552-1-AP targets BAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31042

  Product name: Recombinant human BAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001188

  Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL

• Full Name: BCL2-antagonist/killer 1
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: NM_001188
• Gene Symbol: BAK1
• Gene ID (NCBI): 578
• RRID: AB_2923596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16611
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Publications

What published studies show

The BAK Polyclonal antibody (Cat# 29552-1-AP) has accumulated 43 citations across journals including Cell Metabolism, ACS Nano, Cell Reports, Nature Communications, Journal of Biological Chemistry, Cell Chemical Biology, iScience, and Poultry Science, among others. Research fields span apoptosis, ferroptosis, pyroptosis, liver fibrosis, cancer (lung, ovarian, melanoma, breast, pancreatic, hepatocellular), diabetes, neuroprotection, mitochondrial dysfunction, and oxidative stress, with applications primarily in WB, IHC, IF, IP, and CoIP.

Automatically generated from the 43 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining; Authors - Ya Liu
human	WB	ACS Nano; Mitochondria-Targeted Microneedles Reverse Doxorubicin Resistance via Apoptosis-Ferroptosis Synergy; Authors - Tianshu Hao
		Cell Rep Med; High-dose ascorbic acid selectively induces pyroptosis in LKB1-deficient lung cancer and sensitizes immunotherapy; Authors - Xiangyu Sun
human	IHC	Environ Int; Genome-wide CRISPR-based screen identifies E2F transcription factor 1 as a regulator and therapeutic target of aristolochic acid-induced nephrotoxicity; Authors - Ziqi Liu
mouse	WB	J Transl Med; TGF-β/JNK axis mediates mitochondrial damage and macrophage cGAS-STING activation in liver Mallory-Denk body pathogenesis; Authors - Yi Shi
		Cell Chem Biol; The BAX/BAK apoptotic checkpoint polices entry to therapy-induced senescence.; Authors - Aislinn Gallagher Aldave