Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BAK Polyclonal antibody

BAK Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

BAK1, Bcl-2 homologous antagonist/killer, Bcl2-L-7, Bcl-2-like protein 7, CDN1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BAK in ?

Tested Applications

Positive WB detected inA431 cells, Neuro-2a cells, HEK-293 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, 4T1 cells, ROS1728 cells
Positive IP detected inA431 cells
Positive IHC detected inhuman colon cancer tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29552-1-AP targets BAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31042

Product name: Recombinant human BAK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of NM_001188

Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL

Predict reactive species
Full Name BCL2-antagonist/killer 1
Calculated Molecular Weight 23 kDa
Observed Molecular Weight23-25 kDa
GenBank Accession NumberNM_001188
Gene Symbol BAK1
Gene ID (NCBI) 578
RRIDAB_2923596
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16611
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Protocols

Product Specific Protocols
IF protocol for BAK antibody 29552-1-APDownload protocol
IHC protocol for BAK antibody 29552-1-APDownload protocol
IP protocol for BAK antibody 29552-1-APDownload protocol
WB protocol for BAK antibody 29552-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BAK Polyclonal antibody (Cat# 29552-1-AP) has accumulated 43 citations across journals including Cell Metabolism, ACS Nano, Cell Reports, Nature Communications, Journal of Biological Chemistry, Cell Chemical Biology, iScience, and Poultry Science, among others. Research fields span apoptosis, ferroptosis, pyroptosis, liver fibrosis, cancer (lung, ovarian, melanoma, breast, pancreatic, hepatocellular), diabetes, neuroprotection, mitochondrial dysfunction, and oxidative stress, with applications primarily in WB, IHC, IF, IP, and CoIP.

SpeciesApplicationTitle
mouseWB

Cell Metab

Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining

Authors - Ya Liu
humanWB

ACS Nano

Mitochondria-Targeted Microneedles Reverse Doxorubicin Resistance via Apoptosis-Ferroptosis Synergy

Authors - Tianshu Hao

Cell Rep Med

High-dose ascorbic acid selectively induces pyroptosis in LKB1-deficient lung cancer and sensitizes immunotherapy

Authors - Xiangyu Sun
humanIHC

Environ Int

Genome-wide CRISPR-based screen identifies E2F transcription factor 1 as a regulator and therapeutic target of aristolochic acid-induced nephrotoxicity

Authors - Ziqi Liu
mouseWB

J Transl Med

TGF-β/JNK axis mediates mitochondrial damage and macrophage cGAS-STING activation in liver Mallory-Denk body pathogenesis

Authors - Yi Shi

Cell Chem Biol

The BAX/BAK apoptotic checkpoint polices entry to therapy-induced senescence.

Authors - Aislinn Gallagher Aldave
Loading...
||
New chat

Able™

正在加载,请稍候...