Tested Applications
| Positive WB detected in | MCF-7 cells, K-562 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28713-1-AP targets TAF9B in WB, IP, IHC, CoIP, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29633 Product name: Recombinant human TAF9B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 133-200 aa of BC010350 Sequence: IKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA Predict reactive species |
| Full Name | TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC010350 |
| Gene Symbol | TAF9B |
| Gene ID (NCBI) | 51616 |
| RRID | AB_3086081 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HBM6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7, transcription initiation factor TFIID subunit 9-like, transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes, may have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. The calculated MW of TAF9B is 28 kDa, 28713-1-AP can detect a band around 30 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TAF9B antibody 28713-1-AP | Download protocol |
| IP protocol for TAF9B antibody 28713-1-AP | Download protocol |
| WB protocol for TAF9B antibody 28713-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TAF9B Polyclonal antibody (Cat# 28713-1-AP) has 1 citation. It appears in Nature Communications (2023), a study on improved in situ characterization of protein complex dynamics at scale using thermal proximity co-aggregation. The research field encompasses structural biology and proteomics, specifically focusing on protein-protein interaction mapping and complex dynamics. The antibody was used for Western blot and co-immunoprecipitation in human samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Improved in situ characterization of protein complex dynamics at scale with thermal proximity co-aggregation |
Reviews
What customers say
The product has one review so far. A researcher used it for Western Blot at a 1:1000 dilution on HEK lysate (lot 00113315) and gave it a 5-star rating, simply calling it a "great antibody." Overall, the limited feedback is positive, with the sole reviewer expressing satisfaction with its performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
aditya (Verified Customer) (03-11-2026) | great antibody
|
