Cyclophilin A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cyclophilin A Polyclonal antibody (10720-1-AP)

• Featured Product
• KD/KO Validated

Cyclophilin A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10720-1-AP Copied!

Publications (49)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

PPIA, Cyclosporin A binding protein, Cyclosporin A-binding protein, CYPA, CYPH

• 

  WB analysis using 10720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 10720-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 10720-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10720-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using Cyclophilin A antibody (10720-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 10720-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Cyclophilin A Polyclonal antibody (10720-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cyclophilin A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, C6 cells, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells
• Positive IHC detected in: human colon cancer tissue, human placenta tissue, human tonsillitis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10720-1-AP targets Cyclophilin A in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1120

  Product name: Recombinant human CYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC005320

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005320
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_2237516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62937
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.

Publications

What published studies show

Anti-Cyclophilin A (Cat# 10720-1-AP) has 49 citations across approximately 40 journals, including Nature Communications, Cell Research, Brain, Molecular Cell, Science Advances, and Journal of Virology. Associated research fields span virology and infectious disease, neurodegeneration (ALS, FTD), oncology (lung, gastric, colorectal, hepatocellular, nasopharyngeal, and tongue cancers), immunology and inflammation, and proteomics.

Automatically generated from the 49 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Res; Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2.; Authors - Shaojun Zhang
		Cancer Res; Genetic Drivers of Sensitivity or Resistance to RAS(ON) Multi-Selective Inhibitors in NRAS-Mutated Melanoma.; Authors - Mona Foth
human	WB	Mol Neurodegener; Decoding distinctive features of plasma extracellular vesicles in amyotrophic lateral sclerosis.; Authors - Laura Pasetto
human	WB,IHC	Nat Commun; PPIA dictates NRF2 stability to promote lung cancer progression; Authors - Weiqiang Lu
		Nat Commun; A dual-pronged host-directed therapeutic targeting cyclophilin A and pathogenic interferon response abrogates virus-triggered pregnancy pathologies.; Authors - Wenzhe Yu
pig	WB	Nat Commun; Cyclophilin A stabilizes the capsid protein p72 to facilitate African swine fever virus replication.; Authors - Hui Kong ; KO Validated