Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, rat brain tissue, mouse spleen tissue, rat spleen tissue, mouse brain tissue |
| Positive IHC detected in | human gliomas tissue, human colon tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10116-1-AP targets GDI2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey, yeast |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0170 Product name: Recombinant human GDI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC005145 Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL Predict reactive species |
| Full Name | GDP dissociation inhibitor 2 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC005145 |
| Gene Symbol | GDI2 |
| Gene ID (NCBI) | 2665 |
| RRID | AB_2279073 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50395 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GDI2 antibody 10116-1-AP | Download protocol |
| WB protocol for GDI2 antibody 10116-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GDI2 Polyclonal antibody (Cat# 10116-1-AP) has 16 citations published in journals including Science, Nature Chemical Biology, Cell Death & Disease, PNAS, Current Biology, Human Molecular Genetics, and Neuropharmacology. Research fields span Rab GTPase signaling, cancer biology (colorectal, gastric, esophageal, thyroid, pancreatic, and lung cancers), Alzheimer's disease, schizophrenia, ciliogenesis, and proteomics.
| Species | Application | Title |
|---|---|---|
Cell Death Dis TRIM39 deficiency inhibits tumor progression and autophagic flux in colorectal cancer via suppressing the activity of Rab7. | ||
Proc Natl Acad Sci U S A Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. | ||
Curr Biol Rab34 GTPase mediates ciliary membrane formation in the intracellular ciliogenesis pathway. | ||
Int J Oncol Proteomics-based identification of a group of apoptosis-related proteins and biomarkers in gastric cancer. |
Reviews
What customers say
The single review for 10116-1-AP was posted by Guo-rong Sun on August 30, 2022. Using lot 00058203 at a 1:2000 dilution on ARPE-19 cells for Western Blot, the reviewer reported "specific and clear results" and gave the product a perfect 5-star rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Guo-rong (Verified Customer) (08-30-2022) | Specific and clear results
 |
