Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Raji cells, U2OS cells, SKOV-3 cells, A549 cells, NCI-H1299 cells, Calu-3 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60060-1-Ig targets Follistatin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, camel |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0775 Product name: Recombinant human FST protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC004107 Sequence: MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW Predict reactive species |
| Full Name | follistatin |
| Calculated Molecular Weight | 33 aa, 7 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC004107 |
| Gene Symbol | Follistatin |
| Gene ID (NCBI) | 10468 |
| RRID | AB_2106706 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P19883 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Follistatin (FST) is a member of the tissue growth factor β family and is a secreted glycoprotein that antagonizes many members of the family, including activin A, growth differentiation factor11 , and myostatin. It binds activin A with high affinity and whose expression can be induced by activin A and several other pro-inflammatory cytokines. Activin A-follistatin complexes are biologically inactive and bind to cell surface heparan sulphate-containing proteoglycans for internalisation and degradation. It has also been found to play a significant role in the management of skeletal muscle size and mass. It also has important roles in early embryonic development, differentiation of ovarian granulosa cells, liver fibrosis and polycystic ovarian syndrome. FS 288 glycosylation results in a major species of 35 kDa and a less abundant 40 kDa and minor products of 40 and 42 kDa (PMID: 9785474). Three typical follistatin bands are at 32, 35, and 39 kDa (PMID: 2036994).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Follistatin antibody 60060-1-Ig | Download protocol |
| IHC protocol for Follistatin antibody 60060-1-Ig | Download protocol |
| WB protocol for Follistatin antibody 60060-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Follistatin antibody (Cat# 60060-1-Ig) has 13 total citations spanning journals including Advanced Science, Fertility and Sterility, Antioxidants & Redox Signaling, CNS Neuroscience & Therapeutics, Cells, Frontiers in Pharmacology, iScience, Frontiers in Molecular Biosciences, Experimental Cell Research, Diabetes, Metabolic Syndrome and Obesity, Experimental Dermatology, Animals, and PeerJ. Research fields cover nephrology, cardiology, oncology, reproductive biology, fibrosis, NAFLD, neuroscience, and wound healing.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Microfluidic Biochip-Based Multiplexed Profiling of Small Extracellular Vesicles Proteins Integrated with Machine Learning for Early Disease Diagnosis | ||
Fertil Steril Myostatin, follistatin and activin type II receptors are highly expressed in adenomyosis. | ||
Antioxid Redox Signal Follistatin Protects against Glomerular Mesangial Cell Apoptosis and Oxidative Stress to Ameliorate Chronic Kidney Disease. | ||
CNS Neurosci Ther Integrative Drug-Target Causal Analysis, Single-Cell Sequencing and In-Vivo Validation for Dissecting Molecular Mechanisms Underlying Focal Epilepsy. | ||
Cells Tubule-Derived Follistatin Is Increased in the Urine of Rats with Renal Ischemia and Reflects the Severity of Acute Tubular Damage | ||
Front Pharmacol Follistatin Attenuates Myocardial Fibrosis in Diabetic Cardiomyopathy via the TGF-β-Smad3 Pathway. |
Reviews
What customers say
One reviewer (Jennifer Sosa, July 2023) gave this antibody a low rating after using it at 1:5,000 dilution on HNSCC cell lines by Western Blot. She reported that the antibody produced a single band at ~35 kDa, whereas Follistatin is a glycosylated protein expected to appear as a smear at ~40–50 kDa. Having validated multiple FST antibodies using knockdown and overexpression cell lines, she concluded the antibody likely does not target Follistatin as intended.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jennifer (Verified Customer) (07-17-2023) | I am not sure what this antibody targets, but I am sure it is not Follistatin. This is a glycosylated protein that appears as a smear at ~40 - 50 kDa. However, with this antibody there is a single band at ~ 35 kDa. We have validated several FST antibodies using knock-down and overexpression cell lines so we know what to expect.
|
