Tested Applications
| Positive WB detected in | THP-1 cells, U-937 cells |
| Positive IHC detected in | human lymphoma tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27642-1-AP targets Neutrophil Elastase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26634 Product name: Recombinant human ELA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-267 aa of BC074816 Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH Predict reactive species |
| Full Name | elastase 2, neutrophil |
| Calculated Molecular Weight | 267 aa, 29 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC074816 |
| Gene Symbol | ELA2 |
| Gene ID (NCBI) | 1991 |
| RRID | AB_2918126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08246 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| IHC protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| WB protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Neutrophil Elastase antibody (Cat# 27642-1-AP) has 30 citations across journals including Microbiome, Pharmacological Research, Oncogene, Frontiers in Immunology, ACS Applied Materials & Interfaces, Cancer Immunology Research, Phytomedicine, Scientific Reports, Cell Signaling, and others. Research fields span NETosis, neutrophil-mediated inflammation, acute lung injury, cardiac disease, sepsis, cancer metastasis, atherosclerosis, fibrosis, and autoimmune disorders, primarily in mouse, human, rat, and bovine models using WB, IF, IHC, and ELISA applications.
| Species | Application | Title |
|---|---|---|
Microbiome Periodontitis salivary microbiota exacerbates colitis by CXCL3 derived from gut microbiota-induced macrophages. | ||
Pharmacol Res Endothelial Hippo pathway regulates the neutrophil niche and lung fibrosis. | ||
Cell Mol Biol Lett Obacunone alleviates ferroptosis during lipopolysaccharide-induced acute lung injury by upregulating Nrf2-dependent antioxidant responses. | ||
Pharmacol Res Cardiac PDK4 promotes neutrophilic PFKL methylation and drives the innate immune response in diabetic myocardial infarction | ||
Phytomedicine Shen Yuan Yi Qi Huo Xue capsules inhibit neutrophil NETosis by regulating the PAD4/NLRP3 signaling pathway to prevent heart failure after myocardial infarction. | ||
Oncogene Chronic stress drives gastric cancer lymph node metastasis via NETosis through a feedforward ACh-NGF axis-mediated PKC-γ/STAT3 pathway. |
Reviews
What customers say
One reviewer (Clotilde M.) gave a 5-star rating, reporting excellent performance of this Elastase antibody in paraffin-embedded immunofluorescence (IF-P). The experiment used FFPE human tonsil tissue with Dako antigen retrieval at pH 9. The primary antibody was applied at 1:100 dilution overnight at 4°C, followed by a Goat anti-Rabbit secondary at 1:1000 for 1 hour at room temperature. Images were captured on a Leica THUNDER microscope at 10x and 20x magnification, yielding clear and reliable results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Clotilde (Verified Customer) (07-13-2026) | This Elastase works perfectly in IF-P. The IF was performed on FFPE human tonsil tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
 |
