Tested Applications
| Positive WB detected in | mouse liver tissue, NIH/3T3 cells, rat liver tissue |
| Positive IHC detected in | human liver tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14739-1-AP targets CYP27A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6408 Product name: Recombinant human CYP27A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 183-531 aa of BC051851 Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC Predict reactive species |
| Full Name | cytochrome P450, family 27, subfamily A, polypeptide 1 |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60-65 kDa |
| GenBank Accession Number | BC051851 |
| Gene Symbol | CYP27A1 |
| Gene ID (NCBI) | 1593 |
| RRID | AB_2089276 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02318 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mitochondrial sterol 27-hydroxylase (CYP27A1) catalyzes oxidative cleavage of the sterol side chain in the bile acid biosynthetic pathway in the liver and 27-hydroxylation of cholesterol in most tissues(PMID:17088262). It belongs to the cytochrome P450 family. CYP27A1 catalyses an important sterol elimination pathway in the macrophage, and consequently may protect against atherosclerosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CYP27A1 antibody 14739-1-AP | Download protocol |
| WB protocol for CYP27A1 antibody 14739-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CYP27A1 Polyclonal antibody (Cat# 14739-1-AP) has 33 citations published in journals including Cell Research, Cancer Research, Cell Discovery, Advanced Science, Journal for ImmunoTherapy of Cancer, Phytomedicine, Journal of Hazardous Materials, Nutrients, Communications Biology, European Journal of Pharmacology, Journal of Lipid Research, Experimental Cell Research, British Journal of Nutrition, and BMC Ophthalmology. Key research fields include bile acid metabolism, cholesterol metabolism, liver disease, cancer metastasis, gut microbiota, preeclampsia, and atherosclerosis.
| Species | Application | Title |
|---|---|---|
Cell Res Tissue-specific transcription reprogramming promotes liver metastasis of colorectal cancer. | ||
Cancer Res ANO1 reprograms cholesterol metabolism and the tumor microenvironment to promote cancer metastasis | ||
Cell Discov A decrease in Flavonifractor plautii and its product, phytosphingosine, predisposes individuals with phlegm-dampness constitution to metabolic disorders | ||
Adv Sci (Weinh) Diabetes Mellitus Facilitates Gallstone Formation Through CXCR2-NETs-Mediated Liver-Bile Barrier Damage. | ||
J Immunother Cancer Multiomics integration analysis identifies tumor cell-derived MIF as a therapeutic target and potentiates anti-PD-1 therapy in osteosarcoma | ||
Phytomedicine Multiomics combined analysis reveals protective effect of 7-O-α-L-rhamnopyranosyl-kaempferol-3-O-β-D-glucopyranoside on autoimmune hepatitis |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot. One user reported a clear, strong single band at the expected molecular weight with minimal background and no non-specific binding, praising its specificity and reliability for CYP27A1 detection. Another confirmed good results in both human and rat liver cells. Overall, users find this antibody highly specific, with clean signals and consistent performance across species.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Meixin (Verified Customer) (10-14-2025) | I tested the CYP27A1 Polyclonal antibody in Western blot, and it worked very well. The signal was clear and strong, with a single clean band at the expected molecular weight. The background was minimal, and no obvious non-specific bands were observed. This antibody shows excellent specificity and reliability, making it a great choice for CYP27A1 detection.
|
kishu (Verified Customer) (06-10-2021) | got good results in WB for human and rat liver cells
|
