Tested Applications
| Positive WB detected in | SKOV-3 cells, A2780 cells |
| Positive IP detected in | SKOV-3 cells |
| Positive IHC detected in | human ovary cancer tissue, human kidney tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21383-1-AP targets Pan-PAX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16018 Product name: Recombinant human pan-PAX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 10-140 aa of BC001060 Sequence: HGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF Predict reactive species |
| Full Name | paired box 8 |
| Calculated Molecular Weight | 450 aa, 48 kDa |
| Observed Molecular Weight | 36-48 kDa |
| GenBank Accession Number | BC001060 |
| Gene Symbol | PAX8 |
| Gene ID (NCBI) | 7849 |
| RRID | AB_10733094 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q06710 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAX genes encode a family of developmentally regulated transcription factors that have been implicated in a number of human and murine congenital disorders, as well as in tumorigenesis. These genes are defined by the presence of an evolutionarily conserved DNA binding domain, termed the paired domain. Many paired domain-containing proteins recognize a common sequence motif. The immunogen of this atnibody is the Paired box domain of PAX family. This antibody is a Pan-PAX antibody.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Pan-PAX antibody 21383-1-AP | Download protocol |
| IHC protocol for Pan-PAX antibody 21383-1-AP | Download protocol |
| IP protocol for Pan-PAX antibody 21383-1-AP | Download protocol |
| WB protocol for Pan-PAX antibody 21383-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Pan-PAX Polyclonal antibody (21383-1-AP) has 7 total citations published in Scientific Signaling, Life Sciences, Molecular Oncology, American Journal of Surgical Pathology, Endocrine, and PLoS One. Research fields span neuroscience (NMDA receptor ubiquitination), kidney repair after nephrectomy, colitis-associated colorectal cancer, diagnostic pathology of male genital neoplasms, thyroid carcinogenesis, and reproductive biology involving oviduct epithelial cells.
| Species | Application | Title |
|---|---|---|
Sci Signal Ubiquitination and functional modification of GluN2B subunit-containing NMDA receptors by Cbl-b in the spinal cord dorsal horn. | ||
Life Sci Notch-mediated Sox9+ cell activation contributes to kidney repair after partial nephrectomy. | ||
Mol Oncol miR-126 downregulates CXCL12 expression in intestinal epithelial cells to suppress the recruitment and function of macrophages and tumorigenesis in a murine model of colitis-associated colorectal cancer | ||
Am J Surg Pathol PAX8 and PAX2 immunostaining facilitates the diagnosis of primary epithelial neoplasms of the male genital tract. | ||
PLoS One Mouse models of sporadic thyroid cancer derived from BRAFV600E alone or in combination with PTEN haploinsufficiency under physiologic TSH levels. |



















