Tested Applications
| Positive WB detected in | COLO 320 cells, Caco-2 cells, T-47D cells |
| Positive IHC detected in | human colon cancer tissue, human prostate cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14437-1-AP targets TMPRSS2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5824 Product name: Recombinant human TMPRSS2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 108-492 aa of BC051839 Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Predict reactive species |
| Full Name | transmembrane protease, serine 2 |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 70, 54, 31 kDa |
| GenBank Accession Number | BC051839 |
| Gene Symbol | TMPRSS2 |
| Gene ID (NCBI) | 7113 |
| RRID | AB_2878058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15393 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumour metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 is a host cell factor that is critical for the spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for the entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMPRSS2 antibody 14437-1-AP | Download protocol |
| IHC protocol for TMPRSS2 antibody 14437-1-AP | Download protocol |
| WB protocol for TMPRSS2 antibody 14437-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
14437-1-AP is an anti-ACE2 antibody with 45 total citations. Citations appear in journals including Nature Microbiology, Nature Communications, European Respiratory Journal, Cell Death & Disease, Theranostics, Advanced Science, Allergy, mBio, PLoS Pathogens, Scientific Reports, Clinical Science, Frontiers in Immunology, and others. Research fields span virology and infectious disease (primarily SARS-CoV-2), immunology, pulmonology, oncology, cardiology, neurology, endocrinology, reproductive biology, and gastroenterology. Applications include Western blot, immunofluorescence, and immunohistochemistry.
| Species | Application | Title |
|---|---|---|
Eur Respir J Influenza virus infection increases ACE2 expression and shedding in human small airway epithelial cells. | ||
Nat Microbiol SARS-CoV-2 Omicron is an immune escape variant with an altered cell entry pathway. | ||
Nat Commun Paeniclostridium sordellii hemorrhagic toxin targets TMPRSS2 to induce colonic epithelial lesions. | ||
Theranostics Environmentally-induced mdig contributes to the severity of COVID-19 through fostering expression of SARS-CoV-2 receptor NRPs and glycan metabolism. | ||
Adv Sci (Weinh) Biomimetic Human Disease Model of SARS-CoV-2 Induced Lung Injury and Immune Responses on Organ Chip System. |
Reviews
What customers say
One reviewer (rated 2/5) used this antibody for Western Blot at 1:2000 on transfected HEK293T cells expressing a C-terminal FLAG-tagged long isoform of TMPRSS2. The antibody failed to distinguish transfected from untransfected cells, while an anti-FLAG control clearly detected the expressed protein. The reviewer suggests the antibody may perform better against endogenous TMPRSS2 but is less effective against tagged constructs.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christine (Verified Customer) (12-14-2021) | I transfected HEK293T cells with a plasmid encoding the long isoform of TMPRSS2 with a FLAG tag at the C terminus. I analysed the expression of TMPRSS2 (not expressed endogenously by HEK293T) with the TMPRSS2 antibody but did not detect any difference between transfected and untransfected cells, whereas I could clearly detect it with an anti FLAG antibody. So this antibody might work better on endogenous TMPRSS2 and not very well against my tagged version?
|
