RPA4 Polyclonal antibody

RPA4 Polyclonal Antibody for WB, IP, ELISA
Cat No. 18144-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

HSU24186, RF-A protein 4, RP A p30, RPA 4, RP-A p30

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse spleen tissue
Positive IP detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18144-1-AP targets RPA4 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12800

Product name: Recombinant human RPA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-261 aa of BC069791

Sequence: MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD

Predict reactive species
Full Name replication protein A4, 34kDa
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight 29-32 kDa
GenBank Accession NumberBC069791
Gene Symbol RPA4
Gene ID (NCBI) 29935
RRIDAB_2180970
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13156
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPA4, also named as RP-A p30, is a 261 amino acid protein, which belongs to the replication factor A protein 2 family. RPA4 is preferentially expressed in placental and colon mucosa. RPA4 as part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. This protein, Rpa4, has 47% identity with Rpa2, the 34-kDa subunit of RPA. (PMID: 7760808)

Protocols

Product Specific Protocols
IP protocol for RPA4 antibody 18144-1-APDownload protocol
WB protocol for RPA4 antibody 18144-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...