Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue, NIH/3T3 cells, rat testis tissue, MCF-7 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21244-1-AP targets ER in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine, zebrafish, bovine, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15738 Product name: Recombinant human ER protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 65-280 aa of BC128573 Sequence: AAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV Predict reactive species |
| Full Name | estrogen receptor 1 |
| Calculated Molecular Weight | 595 aa, 66 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC128573 |
| Gene Symbol | ER |
| Gene ID (NCBI) | 2099 |
| RRID | AB_11042600 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P03372 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The estrogen receptor (ESR, ER) is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. ESR1, also known as ESR or NR3A1, belongs to the nuclear hormone receptor family and NR3 subfamily. It is a nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. ESR1 can activate the transcriptional activity of TFF1.[PMID: 11731608,10970861]
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ER antibody 21244-1-AP | Download protocol |
| IHC protocol for ER antibody 21244-1-AP | Download protocol |
| WB protocol for ER antibody 21244-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Estrogen Receptor Alpha (ERα/ESR1) polyclonal antibody, catalog no. 21244-1-AP, has 209 total citations published across over 100 journals, including Nature Structural & Molecular Biology, Molecular Cell, Journal of Clinical Investigation, Advanced Science, Journal of Medicinal Chemistry, FASEB Journal, and Cell Death & Disease. Research fields span breast cancer and endocrine therapy, reproductive biology, environmental toxicology, bone metabolism, neuroprotection, pharmacology, and oncology.
| Species | Application | Title |
|---|---|---|
Adv Mater Autonomously Motile Nano-PROTACs Act as Protein-Sweeping Robots to Enhance Targeted Protein Degradation. | ||
Drug Resist Updat TRIM24 promotes T-cell lymphoma development and glucocorticoid resistance via FUS-mediated phase separation of the glucocorticoid receptor | ||
Cell Discov Luminal hormone-responsive cells tune the regenerative remodeling of mammary glands in large mammals. | ||
Mol Cell PGC-1α senses the CBC of pre-mRNA to dictate the fate of promoter-proximally paused RNAPII | ||
J Nanobiotechnology Exosome-delivered NR2F1-AS1 and NR2F1 drive phenotypic transition from dormancy to proliferation in treatment-resistant prostate cancer via stabilizing hormonal receptors | ||
Theranostics Single-cell analyses reveal evolution mimicry during the specification of breast cancer subtype |
Reviews
What customers say
Two reviews were found for this product. One user rated it 5 stars after using it for Western Blot on a 231 cell line at a 1:500 dilution, reporting a positive result with no additional comments. Another user gave it 1 star after performing Western Blot on MCF10A/MCF7 cells at a 1:1000 dilution, noting that the antibody produced multiple bands, indicating a specificity concern. Overall, feedback is mixed, with one satisfied user and one dissatisfied with the banding pattern observed.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vignesh (Verified Customer) (12-03-2025) |
|
Wei (Verified Customer) (05-07-2019) | There are multiple bands for this antibody.
 |
