Tested Applications
Positive WB detected in | 37°C incubated mouse brain tissue |
Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 15 publications below |
IF | See 6 publications below |
Product Information
17934-1-AP targets DRD1 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12366 Product name: Recombinant human DRD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 338-446 aa of BC074978 Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT Predict reactive species |
Full Name | dopamine receptor D1 |
Calculated Molecular Weight | 446 aa, 49 kDa |
Observed Molecular Weight | 50-75 kDa |
GenBank Accession Number | BC074978 |
Gene Symbol | DRD1 |
Gene ID (NCBI) | 1812 |
RRID | AB_10598308 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P21728 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Dopamine is a neurotransmitter that plays a crucial role in physical and mental health, such as cardiovascular, hormonal, renal, and central nervous systems (PMID: 29220802). Five subtypes of mammalian dopamine receptors are grouped into two classes, the D1- and D2-like classes. The D1-like class includes D1 and D5 receptors whereas the D2-like class includes D2, D3, D4 subtypes (PMID: 9457173). Dopamine receptor D1 (DRD1) is the most abundant form of dopamine receptor in the central nervous system. DRD1 stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses (PMID: 1977312). DRD1 has a calculated molecular weight of 49 kDa, larger apparent molecular weight of 60-80 kDa may be due to glycosylation (PMID: 1281547; 23821371).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DRD1 antibody 17934-1-AP | Download protocol |
IF protocol for DRD1 antibody 17934-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Non-canonical interplay between glutamatergic NMDA and dopamine receptors shapes synaptogenesis | ||
EMBO Mol Med MicroRNA expression profile and functional analysis reveal that miR-382 is a critical novel gene of alcohol addiction. | ||
Elife The organic cation transporter 2 regulates dopamine D1 receptor signaling at the Golgi apparatus. | ||
J Affect Disord Pramipexole improves depression-like behavior in diabetes mellitus with depression rats by inhibiting NLRP3 inflammasome-mediated neuroinflammation and preventing impaired neuroplasticity | ||
Int J Mol Sci Effects of Maternal High-Fructose Diet on Long Non-Coding RNAs and Anxiety-like Behaviors in Offspring |