Tested Applications
| Positive WB detected in | U-87 MG cells, human placenta tissue, MG-63 cells, pig skin tissue, Saos-2 cells |
| Positive IP detected in | U-87 MG cells |
| Positive IHC detected in | human colon tissue, human breast cancer tissue, human oesophagus cancer tissue, human placenta tissue, human skin cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA, Western Blot applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, mouse, rat, pig, rabbit, chicken, hamster, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK Predict reactive species |
| Full Name | collagen, type I, alpha 2 |
| Calculated Molecular Weight | 1366 aa, 130 kDa |
| Observed Molecular Weight | 130-160 kDa |
| GenBank Accession Number | BC054498 |
| Gene Symbol | COL1A2 |
| Gene ID (NCBI) | 1278 |
| RRID | AB_2082037 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08123 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
| IP protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
| WB protocol for Collagen Type I antibody 14695-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Collagen Type I Polyclonal antibody (Cat# 14695-1-AP) has 1,669 total citations. Key journals include Nature, Science Advances, Advanced Materials, Nature Communications, Biomaterials, Bioactive Materials, Cell Death & Differentiation, Theranostics, Redox Biology, and Journal of Controlled Release. Research fields encompass fibrosis (pulmonary, cardiac, hepatic, renal), bone and cartilage regeneration, wound healing, tissue engineering, cancer, and cardiovascular disease. Primary applications are WB, IF, and IHC across human, mouse, rat, and other species.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther 2-APQC, a small-molecule activator of Sirtuin-3 (SIRT3), alleviates myocardial hypertrophy and fibrosis by regulating mitochondrial homeostasis | ||
Signal Transduct Target Ther Overexpression of STX11 alleviates pulmonary fibrosis by inhibiting fibroblast activation via the PI3K/AKT/mTOR pathway | ||
Gastroenterology Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells | ||
Adv Mater Engineered MSCs Break Endothelial-Myofibroblast Crosstalk in Pulmonary Fibrosis: Reconstructing the Vascular Niche |
Reviews
What customers say
Users report strong and reliable signal for Collagen I across Western Blot and Immunofluorescence applications. The antibody has been validated in diverse samples including fibroblasts, HEK cells, MC3T3-E1 pre-osteoblasts, colon tissue, colon cancer cell lines, lung fibroblasts, and mouse heart tissue. Most reviewers rate it 4–5 stars, praising its sensitivity and specificity. One user noted two bands at 70 kDa in mouse heart, and another recommended stringent wash conditions to reduce ladder staining in Western Blot. Typical dilutions range from 1:400 to 1:2000. Overall, it is well-regarded as a high-performance Collagen I antibody.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
John (Verified Customer) (01-30-2026) | Good collagen antibody for IF. Strong signal. Worked well with calcium phosphate cement cultured cells (MC3T3-E1).
![]() |
p (Verified Customer) (09-23-2024) | Excellent
![]() |
Brice-Emmanuel (Verified Customer) (10-12-2023) | I have 2 bands in 70 kDa
|
S (Verified Customer) (03-20-2023) | Excellent Antibody!
![]() |
Balawant Kumar (Verified Customer) (12-20-2022) | antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line
|
PK (Verified Customer) (07-08-2022) | Very Good
![]() |
Ren Jie (Verified Customer) (06-22-2022) | Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot
|
S (Verified Customer) (12-01-2021) | Excellent
![]() |
Hala (Verified Customer) (02-23-2021) | very good
|
Eistine (Verified Customer) (05-31-2019) | The antibody works pretty good
|












































