PEX5 Fusion Protein

Catalog number: ag3268
  • Print page
  • Download PDF
  • Live Chat

-_-

Freight/Packing £00.00

Size: 09µ/gram

Please visit your regions distributor:


Images See all

PEX5 fusion protein ag3268 SDS-PAGE


Product Name:
human PEX5-6*his fusion protein

Catalog No:
ag3268

Source:
E. coli-derived, T-HIS

Peptide Sequence:
EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
(340 - 639 aa encoded by BC010621)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Purity:
95%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Formulation:
Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.

Reconstitution and Storage


Reconstitution:
Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Shipping:
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Stability and Storage:
Store for up to 12 months at -20°C to -80°C as lyophilized powder.

Storage of Reconstituted Protein:
Short-term storage: Store at 2-8°C for two weeks.
Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Back
to top