Use Able AI chat for product recommendations

Alpha smooth muscle actin Polyclonal antibody

Alpha smooth muscle actin Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

ACTA2, Alpha SMA, a-SMA, smooth muscle actin, Alpha actin 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Alpha smooth muscle actin in ?

Tested Applications

Positive WB detected inmouse heart tissue, mouse brown adipose tissue, mouse kidney tissue, mouse liver tissue, mouse skeletal muscle tissue, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman heart tissue, mouse skeletal muscle tissue, human colon tissue, human liver cancer tissue, stromal tumor tissue, human hysteromyoma tissue, human liver tissue, human small intestine tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23081-1-AP targets Alpha smooth muscle actin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19481

Product name: Recombinant human ACTA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-50 aa of BC017554

Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG

Predict reactive species
Full Name actin, alpha 2, smooth muscle, aorta
Calculated Molecular Weight 377 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC017554
Gene Symbol Alpha smooth muscle actin
Gene ID (NCBI) 59
RRIDAB_2815024
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62736
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACTA2 (also known as α-smooth muscle actin or α-SMA) belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. ACTA2 is primarily expressed in vascular smooth muscle and anti-ACTA2 is commonly used to marker smooth muscle cells. This antibody is specific to the ACTA2. It selectively stains the vascular smooth muscle but not cardiac or skeletal muscle.

Protocols

Product Specific Protocols
IHC protocol for Alpha smooth muscle actin antibody 23081-1-APDownload protocol
IP protocol for Alpha smooth muscle actin antibody 23081-1-APDownload protocol
WB protocol for Alpha smooth muscle actin antibody 23081-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-α-SMA polyclonal antibody (Cat# 23081-1-AP) has accumulated 58 citations in journals including Nature Communications, Advanced Science, Cardiovascular Research, Journal of Translational Medicine, FASEB Journal, and International Journal of Biological Sciences. Associated research fields encompass fibrosis (hepatic, pulmonary, cardiac), oncology (gastric, pancreatic, breast, ovarian), cardiovascular disease (atherosclerosis, hypertension), neurodegeneration (Alzheimer's), diabetes, and developmental biology.

SpeciesApplicationTitle
ratWB,IHC,IF

Bioact Mater

Magnesium ions attenuate tendon graft fibrosis during its ligamentization after ACL reconstruction through modulation of fibroblast to myofibroblast trans-differentiation by promoting PGE2 secretion

Authors - Changhao Xu
mouseIF

Nat Commun

Dental cell type atlas reveals stem and differentiated cell types in mouse and human teeth.

Authors - Jan Krivanek
ratWB

Adv Sci (Weinh)

The Composite Antiadhesion Barrier Facilitated Fibroblast Autophagy Activation for Tendon Repair.

Authors - Zhenyu Sun
mouseIHC

Cardiovasc Res

Plasma levels of trimethylamine-N-oxide can be increased with 'healthy' and 'unhealthy' diets and do not correlate with the extent of atherosclerosis but with plaque instability.

Authors - Yen Chin Koay
ratIHC

Cardiovasc Res

PMID: 23650288

Authors - Fan You-Fei YF
mouseWB,IHC,IF

Cell Death Dis

Targeting sorting nexin 3 to treat pulmonary fibrosis by dual modulating Wnt/β-catenin signaling.

Authors - Dinghu Ma
Loading...
||
New chat

Able™

正在加载,请稍候...